PDB entry 3e95

View 3e95 on RCSB PDB site
Description: Crystal Structure of the Plasmodium Falciparum ubiquitin conjugating enzyme complex, PfUBC13-PfUev1a
Class: ligase
Keywords: malaria ubiquitin complex structural genomics, Ligase, Ubl conjugation pathway, Structural Genomics Consortium, SGC
Deposited on 2008-08-21, released 2008-09-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin carrier protein
    Species: Plasmodium falciparum 3D7 [TaxId:36329]
    Gene: PFE1350c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e95a_
  • Chain 'B':
    Compound: Ubiquitin carrier protein
    Species: Plasmodium falciparum 3D7 [TaxId:36329]
    Gene: PFE1350c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e95b_
  • Chain 'C':
    Compound: Ubiquitin-conjugating enzyme E2
    Species: Plasmodium falciparum 3D7 [TaxId:36329]
    Gene: MAL3P2.20, PFC0255c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e95c_
  • Heterogens: UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3e95A (A:)
    giprritketqnlanepppgimavpvpenyrhfnilingpdgtpyeggtyklelflpeqy
    pmeppkvrfltkiyhpnidklgricldilkdkwspalqirtvllsiqallsspepddpld
    skvaehfkqdkndaehvarqwnkiyannnvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e95A (A:)
    iprritketqnlanepppgimavpvpenyrhfnilingpdgtpyeggtyklelflpeqyp
    meppkvrfltkiyhpnidklgricldildkwspalqirtvllsiqallsspepddpldsk
    vaehfkqdkndaehvarqwnkiyannn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3e95B (B:)
    giprritketqnlanepppgimavpvpenyrhfnilingpdgtpyeggtyklelflpeqy
    pmeppkvrfltkiyhpnidklgricldilkdkwspalqirtvllsiqallsspepddpld
    skvaehfkqdkndaehvarqwnkiyannnvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e95B (B:)
    iprritketqnlanepppgimavpvpenyrhfnilingpdgtpyeggtyklelflpeqyp
    meppkvrfltkiyhpnidklgricldilkdkwspalqirtvllsiqallsspepdddskv
    aehfkqdkndaehvarqwnkiyannn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3e95C (C:)
    mhhhhhhssgrenlyfqgmsevivprsfrlldelergqkgnvsegvsfglesadditlsn
    wsctifgqpgtvfenriysltifcddnypdspptvkfdtkiemscvdncgrviknnlhil
    knwnrnytietilislrqemlssankrlpqpnegevys
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e95C (C:)
    evivprsfrlldelergqkgnvsegvsfglesadditlsnwsctifgqpgtvfenriysl
    tifcddnypdspptvkfdtkiemscvdncgrviknnlhilknwnrnytietilislrqem
    lssankrlpqpnegevys