PDB entry 3e92

View 3e92 on RCSB PDB site
Description: Crystal Structure of P38 Kinase in Complex with A Biaryl Amide Inhibitor
Class: transferase
Keywords: P38, SERINE/THREONINE PROTEIN KINASE, MAP KINASE, ATP-binding, Kinase, Nucleotide-binding, Nucleus, Phosphoprotein, Serine/threonine-protein kinase, TRANSFERASE
Deposited on 2008-08-21, released 2008-09-30
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.174
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3e92a_
  • Heterogens: G6A, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3e92A (A:)
    mkkghhlhhhgmsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglr
    vavkklsrpfqsiihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlm
    gadlnnivkcqkltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildf
    glarhtddemtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhi
    dqlklilrlvgtpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekml
    vldsdkritaaqalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfv
    pppldqeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e92A (A:)
    qerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsi
    ihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkl
    tddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglahtddemtgyv
    atrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpg
    aellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqal
    ahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvppp