PDB entry 3e8u

View 3e8u on RCSB PDB site
Description: Crystal structure and thermodynamic analysis of diagnostic Fab 106.3 complexed with BNP 5-13 (C10A) reveal basis of selective molecular recognition
Class: immune system
Keywords: Fab 106.3, IgG1, Brain Natriuretic Peptide (BNP), IMMUNE SYSTEM
Deposited on 2008-08-20, released 2009-07-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab 106.3 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3E8U (0-216)
  • Chain 'L':
    Compound: Fab 106.3 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3E8U (0-215)
    Domains in SCOPe 2.07: d3e8ul1, d3e8ul2
  • Chain 'P':
    Compound: BNP peptide epitope
    Database cross-references and differences (RAF-indexed):
    • PDB 3E8U (0-10)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e8uL (L:)
    dnvltqsppslavslgqratisckasqsvdyngdsylnwyqqkpgqppkfliyaasnles
    giparfsgsgsgtdfnlnihpveeedaatyycqqsnedpftfgsgtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'P':
    No sequence available.