PDB entry 3e8m

View 3e8m on RCSB PDB site
Description: Structure-function Analysis of 2-Keto-3-deoxy-D-glycero-D-galacto-nononate-9-phosphate (KDN) Phosphatase Defines a New Clad Within the Type C0 HAD Subfamily
Class: transferase
Keywords: 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, Nucleotidyltransferase, Transferase
Deposited on 2008-08-20, released 2008-11-04
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.128
AEROSPACI score: 0.95 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acylneuraminate cytidylyltransferase
    Species: Bacteroides thetaiotaomicron [TaxId:818]
    Gene: BT_1713
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3e8ma_
  • Chain 'B':
    Compound: Acylneuraminate cytidylyltransferase
    Species: Bacteroides thetaiotaomicron [TaxId:818]
    Gene: BT_1713
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3e8mb_
  • Chain 'C':
    Compound: Acylneuraminate cytidylyltransferase
    Species: Bacteroides thetaiotaomicron [TaxId:818]
    Gene: BT_1713
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3e8mc_
  • Chain 'D':
    Compound: Acylneuraminate cytidylyltransferase
    Species: Bacteroides thetaiotaomicron [TaxId:818]
    Gene: BT_1713
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3e8md_
  • Heterogens: MG, CL, ACY, PEG, PG4, EDO, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e8mA (A:)
    mkeikliltdidgvwtdggmfydqtgnewkkfntsdsagifwahnkgipvgiltgektei
    vrrraeklkvdylfqgvvdklsaaeelcnelginleqvayigddlndakllkrvgiagvp
    asapfyirrlstiflekrggegvfrefvekvlginledfiaviq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e8mB (B:)
    mkeikliltdidgvwtdggmfydqtgnewkkfntsdsagifwahnkgipvgiltgektei
    vrrraeklkvdylfqgvvdklsaaeelcnelginleqvayigddlndakllkrvgiagvp
    asapfyirrlstiflekrggegvfrefvekvlginledfiaviq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e8mC (C:)
    mkeikliltdidgvwtdggmfydqtgnewkkfntsdsagifwahnkgipvgiltgektei
    vrrraeklkvdylfqgvvdklsaaeelcnelginleqvayigddlndakllkrvgiagvp
    asapfyirrlstiflekrggegvfrefvekvlginledfiaviq
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e8mD (D:)
    mkeikliltdidgvwtdggmfydqtgnewkkfntsdsagifwahnkgipvgiltgektei
    vrrraeklkvdylfqgvvdklsaaeelcnelginleqvayigddlndakllkrvgiagvp
    asapfyirrlstiflekrggegvfrefvekvlginledfiaviq