PDB entry 3e8l

View 3e8l on RCSB PDB site
Description: The Crystal Structure of the Double-headed Arrowhead Protease Inhibitor A in Complex with Two Trypsins
Class: hydrolase inhibitor/hydrolase
Keywords: beta-trefoil fold, protease inhibitor, trypsin, complex, Digestion, Hydrolase, Metal-binding, Protease, Secreted, Serine protease, Zymogen, HYDROLASE INHIBITOR-HYDROLASE COMPLEX
Deposited on 2008-08-20, released 2009-07-28
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.48 Å
R-factor: 0.197
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3e8la_
  • Chain 'B':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3e8lb_
  • Chain 'C':
    Compound: Serine proteinase inhibitor A
    Species: Sagittaria sagittifolia [TaxId:4451]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7M1P4 (9-184)
      • engineered (46)
      • engineered (179)
  • Heterogens: GOL, ACT, SO4, NA, CA, EDO, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3e8lA (A:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3e8lB (B:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

  • Chain 'C':
    No sequence available.