PDB entry 3e8j

View 3e8j on RCSB PDB site
Description: Coproporphyrinogen III oxidase from Leishmania naiffi
Class: oxidoreductase
Keywords: heme metabolism, medical structural genomics of pathogenic protozoa consortium, msgpp, heme biosynthesis, oxidoreductase, porphyrin biosynthesis
Deposited on 2008-08-19, released 2008-09-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.27 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Coproporphyrinogen III oxidase
    Species: Leishmania naiffi [TaxId:5678]
    Gene: similar to LbrM06_V2.1260
    Database cross-references and differences (RAF-indexed):
    • PDB 3E8J (Start-305)
    Domains in SCOPe 2.08: d3e8ja_
  • Chain 'B':
    Compound: Coproporphyrinogen III oxidase
    Species: Leishmania naiffi [TaxId:5678]
    Gene: similar to LbrM06_V2.1260
    Database cross-references and differences (RAF-indexed):
    • PDB 3E8J (Start-305)
    Domains in SCOPe 2.08: d3e8jb_
  • Heterogens: ACT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3e8jA (A:)
    gpgsmmslpveavkefllklqddichaieaedeqatfmedkwtregggggrtrviangav
    iekggvnfshvygkglpgssterhpdmagcnyqamgvslvihpknphvptshanvrlfva
    ekegkepvwwfgggfdltpyyaveedcyyfhhvaqelcrpfgadvyerfkawcdeyffip
    hrneargigglffddlnewpfekcfafmqavgkgfidayipivnrrkntpyteqqvefqe
    frrgryaefnlvidrgtkfglqsggrtesilmslpprarwgynwhpepgtpearlteyfl
    tkkqwv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e8jA (A:)
    lpveavkefllklqddichaieaedeqatfmedkwtregggggrtrviangaviekggvn
    fshvygkgcnyqamgvslvihpknphvptshanvrlfvaekegkepvwwfgggfdltpyy
    aveedcyyfhhvaqelcrpfgadvyerfkawcdeyffiphrneargigglffddlnewpf
    ekcfafmqavgkgfidayipivnrrkntpyteqqvefqefrrgryaefnlvidrgtkfgl
    qsggrtesilmslpprarwgynwhpepgtpearlteyfltkkqwv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3e8jB (B:)
    gpgsmmslpveavkefllklqddichaieaedeqatfmedkwtregggggrtrviangav
    iekggvnfshvygkglpgssterhpdmagcnyqamgvslvihpknphvptshanvrlfva
    ekegkepvwwfgggfdltpyyaveedcyyfhhvaqelcrpfgadvyerfkawcdeyffip
    hrneargigglffddlnewpfekcfafmqavgkgfidayipivnrrkntpyteqqvefqe
    frrgryaefnlvidrgtkfglqsggrtesilmslpprarwgynwhpepgtpearlteyfl
    tkkqwv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e8jB (B:)
    mslpveavkefllklqddichaieaedeqatfmedkwtregggggrtrviangaviekgg
    vnfshvygkggcnyqamgvslvihpknphvptshanvrlfvaegkepvwwfgggfdltpy
    yaveedcyyfhhvaqelcrpfgadvyerfkawcdeyffiphrneargigglffddlnewp
    fekcfafmqavgkgfidayipivnrrkntpyteqqvefqefrrgryaefnlvidrgtkfg
    lqsggrtesilmslpprarwgynwhpepgtpearlteyfltkkqwv