PDB entry 3e8f

View 3e8f on RCSB PDB site
Description: crystal structure of the the open nak channel- k+/ba2+
Deposited on 2008-08-19, released 2008-12-23
The last revision was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Potassium channel protein
    Species: Bacillus cereus [TaxId:1396]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81HW2 (Start-91)
      • expression tag (92-94)
  • Chain 'B':
    Compound: Potassium channel protein
    Species: Bacillus cereus [TaxId:1396]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81HW2 (0-91)
      • expression tag (92-95)
  • Heterogens: MPD, BA, K, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3e8fA (A:)
    wkdkefqvlfvltiltlisgtifystveglrpidalyfsvvtlttvgdgnfspqtdfgki
    ftilyifigiglvfgfihklavnvqlpsilsnlvpr
    

    Sequence, based on observed residues (ATOM records):
    >3e8fA (A:)
    efqvlfvltiltlisgtifystveglrpidalyfsvvtlttvgdgnfspqtdfgkiftil
    yifigiglvfgfihklavnvqlpsilsnlvp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3e8fB (B:)
    wkdkefqvlfvltiltlisgtifystveglrpidalyfsvvtlttvgdgnfspqtdfgki
    ftilyifigiglvfgfihklavnvqlpsilsnlvpr