PDB entry 3e8e

View 3e8e on RCSB PDB site
Description: Crystal structures of the kinase domain of PKA in complex with ATP-competitive inhibitors
Class: transferase
Keywords: PKA, AKT2, kinase, PKI, bovine, inhibitor, ATP-binding, cAMP, Lipoprotein, Myristate, Nucleotide-binding, Nucleus, Phosphoprotein, Serine/threonine-protein kinase, Transferase
Deposited on 2008-08-19, released 2008-11-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-11-19, with a file datestamp of 2014-11-14.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.245
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-dependent protein kinase catalytic subunit alpha
    Species: Bos taurus [TaxId:9913]
    Gene: PKA, PRKACA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3e8ea_
  • Chain 'B':
    Compound: cAMP-dependent protein kinase catalytic subunit alpha
    Species: Bos taurus [TaxId:9913]
    Gene: PKA, PRKACA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3e8eb_
  • Chain 'C':
    Compound: PKI inhibitor peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: cAMP-dependent protein kinase catalytic subunit alpha
    Species: Bos taurus [TaxId:9913]
    Gene: PKA, PRKACA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3e8ee_
  • Chain 'F':
    Compound: PKI inhibitor peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: PKI inhibitor peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: cAMP-dependent protein kinase catalytic subunit alpha
    Species: Bos taurus [TaxId:9913]
    Gene: PKA, PRKACA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3e8ei_
  • Chain 'J':
    Compound: PKI inhibitor peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: cAMP-dependent protein kinase catalytic subunit alpha
    Species: Bos taurus [TaxId:9913]
    Gene: PKA, PRKACA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3e8el_
  • Chain 'N':
    Compound: PKI inhibitor peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: cAMP-dependent protein kinase catalytic subunit alpha
    Species: Bos taurus [TaxId:9913]
    Gene: PKA, PRKACA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3e8ep_
  • Chain 'Q':
    Compound: PKI inhibitor peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: G98, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3e8eA (A:)
    gnaaaakkgseqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlv
    khmetgnhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvm
    eyvpggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyi
    qvtdfgfakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffa
    dqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfatt
    dwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e8eA (A:)
    kkgseqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhmetg
    nhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpgg
    emfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfg
    fakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqi
    yekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiy
    qrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3e8eB (B:)
    gnaaaakkgseqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlv
    khmetgnhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvm
    eyvpggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyi
    qvtdfgfakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffa
    dqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfatt
    dwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e8eB (B:)
    qesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhmetgnhyam
    kildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpggemfsh
    lrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakrv
    kgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekiv
    sgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkve
    apfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

  • Chain 'C':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3e8eE (E:)
    gnaaaakkgseqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlv
    khmetgnhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvm
    eyvpggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyi
    qvtdfgfakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffa
    dqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfatt
    dwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e8eE (E:)
    kkgseqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhmetg
    nhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpgg
    emfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfg
    fakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqi
    yekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiy
    qrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3e8eI (I:)
    gnaaaakkgseqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlv
    khmetgnhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvm
    eyvpggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyi
    qvtdfgfakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffa
    dqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfatt
    dwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e8eI (I:)
    aaaakkgseqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkh
    metgnhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmey
    vpggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqv
    tdfgfakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadq
    piqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdw
    iaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

  • Chain 'J':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3e8eL (L:)
    gnaaaakkgseqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlv
    khmetgnhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvm
    eyvpggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyi
    qvtdfgfakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffa
    dqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfatt
    dwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e8eL (L:)
    esvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhmetgnhyamk
    ildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpggemfshl
    rrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakrvk
    grtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekivs
    gkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkvea
    pfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

  • Chain 'N':
    No sequence available.

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3e8eP (P:)
    gnaaaakkgseqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlv
    khmetgnhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvm
    eyvpggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyi
    qvtdfgfakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffa
    dqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfatt
    dwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e8eP (P:)
    kkgseqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhmetg
    nhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpgg
    emfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfg
    fakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqi
    yekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiy
    qrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

  • Chain 'Q':
    No sequence available.