PDB entry 3e8d

View 3e8d on RCSB PDB site
Description: Crystal structures of the kinase domain of AKT2 in complex with ATP-competitive inhibitors
Class: transferase
Keywords: AKT2, kinase, GSK3 beta, ATP-binding, Nucleotide-binding, Phosphoprotein, Serine/threonine-protein kinase, Transferase, Wnt signaling pathway
Deposited on 2008-08-19, released 2008-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rac-beta serine/threonine-protein kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: AKT2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31751 (0-334)
      • engineered (328)
    Domains in SCOPe 2.07: d3e8da_
  • Chain 'B':
    Compound: rac-beta serine/threonine-protein kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: AKT2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31751 (0-334)
      • engineered (328)
    Domains in SCOPe 2.07: d3e8db_
  • Chain 'C':
    Compound: Glycogen synthase kinase-3 beta peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Glycogen synthase kinase-3 beta peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: G98, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3e8dA (A:)
    kvtmndfdylkllgkgtfgkvilvrekatgryyamkilrkeviiakdevahtvtesrvlq
    ntrhpfltalkyafqthdrlcfvmeyanggelffhlsrervfteerarfygaeivsaley
    lhsrdvvyrdiklenlmldkdghikitdfglckegisdgatmktfcgtpeylapevledn
    dygravdwwglgvvmyemmcgrlpfynqdherlfelilmeeirfprtlspeaksllagll
    kkdpkqrlgggpsdakevmehrfflsinwqdvvqkkllppfkpqvtsevdtryfddefta
    qsititppdrydslglleldqrthfpqfdysasir
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e8dA (A:)
    kvtmndfdylkllgkgtfgkvilvrekatgryyamkilrkeviiakdevahtvtesrvlq
    ntrhpfltalkyafqthdrlcfvmeyanggelffhlsrervfteerarfygaeivsaley
    lhsrdvvyrdiklenlmldkdghikitdfglckegisdgatmktfcgtpeylapevledn
    dygravdwwglgvvmyemmcgrlpfynqdherlfelilmeeirfprtlspeaksllagll
    kkdpkqrlgggpsdakevmehrfflsinwqdvvqkkllppfkpqvtsevdtryfddefta
    qsithfpqfdysasir
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3e8dB (B:)
    kvtmndfdylkllgkgtfgkvilvrekatgryyamkilrkeviiakdevahtvtesrvlq
    ntrhpfltalkyafqthdrlcfvmeyanggelffhlsrervfteerarfygaeivsaley
    lhsrdvvyrdiklenlmldkdghikitdfglckegisdgatmktfcgtpeylapevledn
    dygravdwwglgvvmyemmcgrlpfynqdherlfelilmeeirfprtlspeaksllagll
    kkdpkqrlgggpsdakevmehrfflsinwqdvvqkkllppfkpqvtsevdtryfddefta
    qsititppdrydslglleldqrthfpqfdysasir
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e8dB (B:)
    kvtmndfdylkllgkgtfgkvilvrekatgryyamkilrkeviiakdevahtvtesrvlq
    ntrhpfltalkyafqthdrlcfvmeyanggelffhlsrervfteerarfygaeivsaley
    lhsrdvvyrdiklenlmldkdghikitdfglckegisdgatmktfcgtpeylapevledn
    dygravdwwglgvvmyemmcgrlpfynqdherlfelilmeeirfprtlspeaksllagll
    kkdpkqrlgggpsdakevmehrfflsinwqdvvqkkllppfkpqvtsevdtryfddefta
    qsiqrthfpqfdysasir
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.