PDB entry 3e8c

View 3e8c on RCSB PDB site
Description: Crystal structures of the kinase domain of PKA in complex with ATP-competitive inhibitors
Class: transferase
Keywords: PKA, AKT2, kinase, PKI, bovine, inhibitor, ATP-binding, cAMP, Lipoprotein, Myristate, Nucleotide-binding, Nucleus, Phosphoprotein, Serine/threonine-protein kinase, Transferase, Protein kinase inhibitor
Deposited on 2008-08-19, released 2008-11-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.265
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-dependent protein kinase catalytic subunit alpha
    Species: Bos taurus [TaxId:9913]
    Gene: PKA, PRKACA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3e8ca_
  • Chain 'B':
    Compound: cAMP-dependent protein kinase catalytic subunit alpha
    Species: Bos taurus [TaxId:9913]
    Gene: PKA, PRKACA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3e8cb_
  • Chain 'C':
    Compound: cAMP-dependent protein kinase catalytic subunit alpha
    Species: Bos taurus [TaxId:9913]
    Gene: PKA, PRKACA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3e8cc_
  • Chain 'D':
    Compound: cAMP-dependent protein kinase catalytic subunit alpha
    Species: Bos taurus [TaxId:9913]
    Gene: PKA, PRKACA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3e8cd_
  • Chain 'E':
    Compound: cAMP-dependent protein kinase catalytic subunit alpha
    Species: Bos taurus [TaxId:9913]
    Gene: PKA, PRKACA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3e8ce_
  • Chain 'F':
    Compound: cAMP-dependent protein kinase catalytic subunit alpha
    Species: Bos taurus [TaxId:9913]
    Gene: PKA, PRKACA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3e8cf_
  • Chain 'G':
    Compound: cAMP-dependent protein kinase inhibitor peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: cAMP-dependent protein kinase inhibitor peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: cAMP-dependent protein kinase inhibitor peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: cAMP-dependent protein kinase inhibitor peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: cAMP-dependent protein kinase inhibitor peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: cAMP-dependent protein kinase inhibitor peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: G96, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3e8cA (A:)
    gnaaaakkgseqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlv
    khmetgnhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvm
    eyvpggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyi
    qvtdfgfakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffa
    dqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfatt
    dwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e8cA (A:)
    kkgseqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhmetg
    nhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpgg
    emfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfg
    fakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqi
    yekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiy
    qrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3e8cB (B:)
    gnaaaakkgseqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlv
    khmetgnhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvm
    eyvpggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyi
    qvtdfgfakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffa
    dqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfatt
    dwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e8cB (B:)
    aaakkgseqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhm
    etgnhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyv
    pggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvt
    dfgfakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqp
    iqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwi
    aiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3e8cC (C:)
    gnaaaakkgseqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlv
    khmetgnhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvm
    eyvpggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyi
    qvtdfgfakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffa
    dqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfatt
    dwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e8cC (C:)
    kkgseqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhmetg
    nhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpgg
    emfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfg
    fakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqi
    yekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiy
    qrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3e8cD (D:)
    gnaaaakkgseqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlv
    khmetgnhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvm
    eyvpggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyi
    qvtdfgfakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffa
    dqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfatt
    dwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e8cD (D:)
    aaakkgseqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhm
    etgnhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyv
    pggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvt
    dfgfakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqp
    iqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwi
    aiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3e8cE (E:)
    gnaaaakkgseqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlv
    khmetgnhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvm
    eyvpggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyi
    qvtdfgfakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffa
    dqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfatt
    dwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e8cE (E:)
    esvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhmetgnhyamk
    ildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpggemfshl
    rrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakrvk
    grtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekivs
    gkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkvea
    pfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3e8cF (F:)
    gnaaaakkgseqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlv
    khmetgnhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvm
    eyvpggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyi
    qvtdfgfakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffa
    dqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfatt
    dwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e8cF (F:)
    kkgseqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhmetg
    nhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpgg
    emfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfg
    fakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqi
    yekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiy
    qrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.