PDB entry 3e84

View 3e84 on RCSB PDB site
Description: Structure-function Analysis of 2-Keto-3-deoxy-D-glycero-D-galacto-nononate-9-phosphate (KDN) Phosphatase Defines a New Clad Within the Type C0 HAD Subfamily
Class: transferase
Keywords: 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, Nucleotidyltransferase, Transferase
Deposited on 2008-08-19, released 2008-11-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acylneuraminate cytidylyltransferase
    Species: Bacteroides thetaiotaomicron [TaxId:818]
    Gene: BT1713
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e84a_
  • Chain 'B':
    Compound: Acylneuraminate cytidylyltransferase
    Species: Bacteroides thetaiotaomicron [TaxId:818]
    Gene: BT1713
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e84b_
  • Chain 'C':
    Compound: Acylneuraminate cytidylyltransferase
    Species: Bacteroides thetaiotaomicron [TaxId:818]
    Gene: BT1713
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e84c_
  • Chain 'D':
    Compound: Acylneuraminate cytidylyltransferase
    Species: Bacteroides thetaiotaomicron [TaxId:818]
    Gene: BT1713
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e84d_
  • Heterogens: MG, WO4, PEG, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e84A (A:)
    mkeikliltdidgvwtdggmfydqtgnewkkfntsdsagifwahnkgipvgiltgektei
    vrrraeklkvdylfqgvvdklsaaeelcnelginleqvayigddlndakllkrvgiagvp
    asapfyirrlstiflekrggegvfrefvekvlginledfiaviq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e84B (B:)
    mkeikliltdidgvwtdggmfydqtgnewkkfntsdsagifwahnkgipvgiltgektei
    vrrraeklkvdylfqgvvdklsaaeelcnelginleqvayigddlndakllkrvgiagvp
    asapfyirrlstiflekrggegvfrefvekvlginledfiaviq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e84C (C:)
    mkeikliltdidgvwtdggmfydqtgnewkkfntsdsagifwahnkgipvgiltgektei
    vrrraeklkvdylfqgvvdklsaaeelcnelginleqvayigddlndakllkrvgiagvp
    asapfyirrlstiflekrggegvfrefvekvlginledfiaviq
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e84D (D:)
    mkeikliltdidgvwtdggmfydqtgnewkkfntsdsagifwahnkgipvgiltgektei
    vrrraeklkvdylfqgvvdklsaaeelcnelginleqvayigddlndakllkrvgiagvp
    asapfyirrlstiflekrggegvfrefvekvlginledfiaviq