PDB entry 3e7o

View 3e7o on RCSB PDB site
Description: Crystal Structure of JNK2
Class: transferase
Keywords: MAP kinase insert, activation loop, indazole inhibitor, Alternative splicing, ATP-binding, Kinase, Nucleotide-binding, Phosphoprotein, Polymorphism, Serine/threonine-protein kinase, Transferase
Deposited on 2008-08-18, released 2008-09-09
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-12-01, with a file datestamp of 2009-11-27.
Experiment type: XRAY
Resolution: 2.14 Å
R-factor: 0.219
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 9
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK9, JNK2, PRKM9
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45984
      • engineered (174)
      • engineered (219)
      • engineered (247-248)
      • engineered (262)
      • engineered (267)
    Domains in SCOPe 2.04: d3e7oa_
  • Chain 'B':
    Compound: Mitogen-activated protein kinase 9
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK9, JNK2, PRKM9
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45984 (Start-359)
      • engineered (219)
      • engineered (247-248)
      • engineered (262)
      • engineered (267)
    Domains in SCOPe 2.04: d3e7ob_
  • Heterogens: 35F, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3e7oA (A:)
    gshmdsqfysvqvadstftvlkryqqlkpigsgaqgivcaafdtvlginvavkklsrpfq
    nqthakrayrelvllkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqvihme
    ldhermsyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartastnfmm
    tpyvvtryyrapevilgmgykenvdiwsvgcimgelvkgsvifqgtdhidqwnkvieqlg
    tpsaefmaalqptvrnyvenrpaypgiafeelfpdwifpseserdkiktsqardllskml
    vidpdkrisvdealrhpyitvwydpaeaeapppqiydaqleerehaieewkeliykevmd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e7oA (A:)
    qfysvqvadstftvlkryqqlkpigsgaqgivcaafdtvlginvavkklsrpfqnqthak
    rayrelvllkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqvihmeldherm
    syllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartastnfmmtpyvvt
    ryyrapevilgmgykenvdiwsvgcimgelvkgsvifqgtdhidqwnkvieqlgtpsaef
    maalqptvrnyvenrpaypgiafeelfpdwifpserdkiktsqardllskmlvidpdkri
    svdealrhpyitvwydpaeaeapppqihaieewkeliykevm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3e7oB (B:)
    gshmdsqfysvqvadstftvlkryqqlkpigsgaqgivcaafdtvlginvavkklsrpfq
    nqthakrayrelvllkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqvihme
    ldhermsyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartastnfmm
    tpyvvtryyrapevilgmgykenvdiwsvgcimgelvkgsvifqgtdhidqwnkvieqlg
    tpsaefmaalqptvrnyvenrpaypgiafeelfpdwifpseserdkiktsqardllskml
    vidpdkrisvdealrhpyitvwydpaeaeapppqiydaqleerehaieewkeliykevmd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e7oB (B:)
    sqfysvqvadstftvlkryqqlkpigsgivcaafdtvlginvavkklsrpfqnqthakra
    yrelvllkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqvihmeldhermsy
    llyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfgtryyrapevilgmgykenv
    diwsvgcimgelvkgsvifqgtdhidqwnkvieqlgtpsaefmaalqptvrnyvenrpay
    pgiafeelfpdwifpseserdkiktsqardllskmlvidpdkrisvdealrhpyitvwyd
    paapppqirehaieewkeliykevmd