PDB entry 3e7n

View 3e7n on RCSB PDB site
Description: Crystal structure of d-ribose high-affinity transport system from salmonella typhimurium lt2
Class: transport protein
Keywords: D-ribose transport system, rbsD,CSGID, Structural Genomics, NIAID Structural Genomics Centers for Infectious Diseases, Center for Structural Genomics of Infectious Diseases, TRANSPORT PROTEIN
Deposited on 2008-08-18, released 2008-08-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.193
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D-ribose high-affinity transport system
    Species: Salmonella typhimurium [TaxId:602]
    Gene: rbsD, STM3881
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZKW0 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d3e7na1, d3e7na2
  • Chain 'B':
    Compound: D-ribose high-affinity transport system
    Species: Salmonella typhimurium [TaxId:602]
    Gene: rbsD, STM3881
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZKW0 (3-141)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d3e7nb1, d3e7nb2
  • Chain 'C':
    Compound: D-ribose high-affinity transport system
    Species: Salmonella typhimurium [TaxId:602]
    Gene: rbsD, STM3881
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZKW0 (3-141)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d3e7nc1, d3e7nc2
  • Chain 'D':
    Compound: D-ribose high-affinity transport system
    Species: Salmonella typhimurium [TaxId:602]
    Gene: rbsD, STM3881
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZKW0 (3-141)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d3e7nd1, d3e7nd2
  • Chain 'E':
    Compound: D-ribose high-affinity transport system
    Species: Salmonella typhimurium [TaxId:602]
    Gene: rbsD, STM3881
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZKW0 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d3e7ne1, d3e7ne2
  • Chain 'F':
    Compound: D-ribose high-affinity transport system
    Species: Salmonella typhimurium [TaxId:602]
    Gene: rbsD, STM3881
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZKW0 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d3e7nf1, d3e7nf2
  • Chain 'G':
    Compound: D-ribose high-affinity transport system
    Species: Salmonella typhimurium [TaxId:602]
    Gene: rbsD, STM3881
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZKW0 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d3e7ng1, d3e7ng2
  • Chain 'H':
    Compound: D-ribose high-affinity transport system
    Species: Salmonella typhimurium [TaxId:602]
    Gene: rbsD, STM3881
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZKW0 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d3e7nh1, d3e7nh2
  • Chain 'I':
    Compound: D-ribose high-affinity transport system
    Species: Salmonella typhimurium [TaxId:602]
    Gene: rbsD, STM3881
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZKW0 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d3e7ni1, d3e7ni2
  • Chain 'J':
    Compound: D-ribose high-affinity transport system
    Species: Salmonella typhimurium [TaxId:602]
    Gene: rbsD, STM3881
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZKW0 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d3e7nj1, d3e7nj2
  • Chain 'K':
    Compound: D-ribose high-affinity transport system
    Species: Salmonella typhimurium [TaxId:602]
    Gene: rbsD, STM3881
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZKW0 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d3e7nk1, d3e7nk2
  • Chain 'L':
    Compound: D-ribose high-affinity transport system
    Species: Salmonella typhimurium [TaxId:602]
    Gene: rbsD, STM3881
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZKW0 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d3e7nl1, d3e7nl2
  • Chain 'M':
    Compound: D-ribose high-affinity transport system
    Species: Salmonella typhimurium [TaxId:602]
    Gene: rbsD, STM3881
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZKW0 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d3e7nm1, d3e7nm2
  • Chain 'N':
    Compound: D-ribose high-affinity transport system
    Species: Salmonella typhimurium [TaxId:602]
    Gene: rbsD, STM3881
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZKW0 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d3e7nn1, d3e7nn2
  • Chain 'O':
    Compound: D-ribose high-affinity transport system
    Species: Salmonella typhimurium [TaxId:602]
    Gene: rbsD, STM3881
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZKW0 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d3e7no1, d3e7no2
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3e7nA (A:)
    snamkkgtvlnseissvisrlghtdtlvvcdaglpipnstaridmaltqgvpsfmqvvdv
    vtremqveaailateikqqnpqlhetllthleqlqqhqgntikisyttheqfkkltadsq
    avirsgecspyanvilcagvtf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e7nA (A:)
    namkkgtvlnseissvisrlghtdtlvvcdaglpipnstaridmaltqgvpsfmqvvdvv
    tremqveaailateikqqnpqlhetllthleqlqqhqgntikisyttheqfkkltadsqa
    virsgecspyanvilcagvt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3e7nB (B:)
    snamkkgtvlnseissvisrlghtdtlvvcdaglpipnstaridmaltqgvpsfmqvvdv
    vtremqveaailateikqqnpqlhetllthleqlqqhqgntikisyttheqfkkltadsq
    avirsgecspyanvilcagvtf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e7nB (B:)
    namkkgtvlnseissvisrlghtdtlvvcdaglpipnstaridmaltqgvpsfmqvvdvv
    tremqveaailateikqqnpqlhetllthleqlqqhqgntikisyttheqfkkltadsqa
    virsgecspyanvilcagvtf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3e7nC (C:)
    snamkkgtvlnseissvisrlghtdtlvvcdaglpipnstaridmaltqgvpsfmqvvdv
    vtremqveaailateikqqnpqlhetllthleqlqqhqgntikisyttheqfkkltadsq
    avirsgecspyanvilcagvtf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e7nC (C:)
    namkkgtvlnseissvisrlghtdtlvvcdaglpipnstaridmaltqgvpsfmqvvdvv
    tremqveaailateikqqnpqlhetllthleqlqqhqgntikisyttheqfkkltadsqa
    virsgecspyanvilcagvtf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3e7nD (D:)
    snamkkgtvlnseissvisrlghtdtlvvcdaglpipnstaridmaltqgvpsfmqvvdv
    vtremqveaailateikqqnpqlhetllthleqlqqhqgntikisyttheqfkkltadsq
    avirsgecspyanvilcagvtf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e7nD (D:)
    namkkgtvlnseissvisrlghtdtlvvcdaglpipnstaridmaltqgvpsfmqvvdvv
    tremqveaailateikqqnpqlhetllthleqlqqhqgntikisyttheqfkkltadsqa
    virsgecspyanvilcagvtf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3e7nE (E:)
    snamkkgtvlnseissvisrlghtdtlvvcdaglpipnstaridmaltqgvpsfmqvvdv
    vtremqveaailateikqqnpqlhetllthleqlqqhqgntikisyttheqfkkltadsq
    avirsgecspyanvilcagvtf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e7nE (E:)
    namkkgtvlnseissvisrlghtdtlvvcdaglpipnstaridmaltqgvpsfmqvvdvv
    tremqveaailateikqqnpqlhetllthleqlqqhqgntikisyttheqfkkltadsqa
    virsgecspyanvilcagvt
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3e7nF (F:)
    snamkkgtvlnseissvisrlghtdtlvvcdaglpipnstaridmaltqgvpsfmqvvdv
    vtremqveaailateikqqnpqlhetllthleqlqqhqgntikisyttheqfkkltadsq
    avirsgecspyanvilcagvtf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e7nF (F:)
    namkkgtvlnseissvisrlghtdtlvvcdaglpipnstaridmaltqgvpsfmqvvdvv
    tremqveaailateikqqnpqlhetllthleqlqqhqgntikisyttheqfkkltadsqa
    virsgecspyanvilcagvt
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3e7nG (G:)
    snamkkgtvlnseissvisrlghtdtlvvcdaglpipnstaridmaltqgvpsfmqvvdv
    vtremqveaailateikqqnpqlhetllthleqlqqhqgntikisyttheqfkkltadsq
    avirsgecspyanvilcagvtf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e7nG (G:)
    namkkgtvlnseissvisrlghtdtlvvcdaglpipnstaridmaltqgvpsfmqvvdvv
    tremqveaailateikqqnpqlhetllthleqlqqhqgntikisyttheqfkkltadsqa
    virsgecspyanvilcagv
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3e7nH (H:)
    snamkkgtvlnseissvisrlghtdtlvvcdaglpipnstaridmaltqgvpsfmqvvdv
    vtremqveaailateikqqnpqlhetllthleqlqqhqgntikisyttheqfkkltadsq
    avirsgecspyanvilcagvtf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e7nH (H:)
    namkkgtvlnseissvisrlghtdtlvvcdaglpipnstaridmaltqgvpsfmqvvdvv
    tremqveaailateikqqnpqlhetllthleqlqqhqgntikisyttheqfkkltadsqa
    virsgecspyanvilcagvt
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3e7nI (I:)
    snamkkgtvlnseissvisrlghtdtlvvcdaglpipnstaridmaltqgvpsfmqvvdv
    vtremqveaailateikqqnpqlhetllthleqlqqhqgntikisyttheqfkkltadsq
    avirsgecspyanvilcagvtf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e7nI (I:)
    namkkgtvlnseissvisrlghtdtlvvcdaglpipnstaridmaltqgvpsfmqvvdvv
    tremqveaailateikqqnpqlhetllthleqlqqhqgntikisyttheqfkkltadsqa
    virsgecspyanvilcagvt
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3e7nJ (J:)
    snamkkgtvlnseissvisrlghtdtlvvcdaglpipnstaridmaltqgvpsfmqvvdv
    vtremqveaailateikqqnpqlhetllthleqlqqhqgntikisyttheqfkkltadsq
    avirsgecspyanvilcagvtf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e7nJ (J:)
    namkkgtvlnseissvisrlghtdtlvvcdaglpipnstaridmaltqgvpsfmqvvdvv
    tremqveaailateikqqnpqlhetllthleqlqqhqgntikisyttheqfkkltadsqa
    virsgecspyanvilcagvt
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3e7nK (K:)
    snamkkgtvlnseissvisrlghtdtlvvcdaglpipnstaridmaltqgvpsfmqvvdv
    vtremqveaailateikqqnpqlhetllthleqlqqhqgntikisyttheqfkkltadsq
    avirsgecspyanvilcagvtf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e7nK (K:)
    namkkgtvlnseissvisrlghtdtlvvcdaglpipnstaridmaltqgvpsfmqvvdvv
    tremqveaailateikqqnpqlhetllthleqlqqhqgntikisyttheqfkkltadsqa
    virsgecspyanvilcagvt
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3e7nL (L:)
    snamkkgtvlnseissvisrlghtdtlvvcdaglpipnstaridmaltqgvpsfmqvvdv
    vtremqveaailateikqqnpqlhetllthleqlqqhqgntikisyttheqfkkltadsq
    avirsgecspyanvilcagvtf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e7nL (L:)
    namkkgtvlnseissvisrlghtdtlvvcdaglpipnstaridmaltqgvpsfmqvvdvv
    tremqveaailateikqqnpqlhetllthleqlqqhqgntikisyttheqfkkltadsqa
    virsgecspyanvilcagv
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3e7nM (M:)
    snamkkgtvlnseissvisrlghtdtlvvcdaglpipnstaridmaltqgvpsfmqvvdv
    vtremqveaailateikqqnpqlhetllthleqlqqhqgntikisyttheqfkkltadsq
    avirsgecspyanvilcagvtf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e7nM (M:)
    namkkgtvlnseissvisrlghtdtlvvcdaglpipnstaridmaltqgvpsfmqvvdvv
    tremqveaailateikqqnpqlhetllthleqlqqhqgntikisyttheqfkkltadsqa
    virsgecspyanvilcagvt
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3e7nN (N:)
    snamkkgtvlnseissvisrlghtdtlvvcdaglpipnstaridmaltqgvpsfmqvvdv
    vtremqveaailateikqqnpqlhetllthleqlqqhqgntikisyttheqfkkltadsq
    avirsgecspyanvilcagvtf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e7nN (N:)
    namkkgtvlnseissvisrlghtdtlvvcdaglpipnstaridmaltqgvpsfmqvvdvv
    tremqveaailateikqqnpqlhetllthleqlqqhqgntikisyttheqfkkltadsqa
    virsgecspyanvilcagvt
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3e7nO (O:)
    snamkkgtvlnseissvisrlghtdtlvvcdaglpipnstaridmaltqgvpsfmqvvdv
    vtremqveaailateikqqnpqlhetllthleqlqqhqgntikisyttheqfkkltadsq
    avirsgecspyanvilcagvtf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e7nO (O:)
    namkkgtvlnseissvisrlghtdtlvvcdaglpipnstaridmaltqgvpsfmqvvdvv
    tremqveaailateikqqnpqlhetllthleqlqqhqgntikisyttheqfkkltadsqa
    virsgecspyanvilcagvt