PDB entry 3e7g

View 3e7g on RCSB PDB site
Description: Structure of human INOSOX with inhibitor AR-C95791
Class: oxidoreductase
Keywords: nitric oxide, NOS, HEME, tetrahydrobiopterin, oxidoreductase, Alternative splicing, Calcium, Calmodulin-binding, FAD, FMN, Iron, Metal-binding, NADP, Phosphoprotein, Polymorphism, Zinc
Deposited on 2008-08-18, released 2008-10-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitric oxide synthase, inducible
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e7ga_
  • Chain 'B':
    Compound: Nitric oxide synthase, inducible
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e7gb_
  • Chain 'C':
    Compound: Nitric oxide synthase, inducible
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e7gc_
  • Chain 'D':
    Compound: Nitric oxide synthase, inducible
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e7gd_
  • Heterogens: ZN, HEM, H4B, AT2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3e7gA (A:)
    prhvriknwgsgmtfqdtlhhkakgiltcrsksclgsimtpksltrgprdkptppdellp
    qaiefvnqyygsfkeakieehlarveavtkeiettgtyqltgdelifatkqawrnaprci
    griqwsnlqvfdarscstaremfehicrhvrystnngnirsaitvfpqrsdgkhdfrvwn
    aqliryagyqmpdgsirgdpanveftqlcidlgwkpkygrfdvvplvlqangrdpelfei
    ppdlvlevamehpkyewfrelelkwyalpavanmllevgglefpgcpfngwymgteigvr
    dfcdvqrynileevgrrmglethklaslwkdqavveiniavlhsfqkqnvtimdhhsaae
    sfmkymqneyrsrggcpadwiwlvppmsgsitpvfhqemlnyvlspfyyyqveawkthvw
    qdek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e7gA (A:)
    rhvriknwgsgmtfqdtlhhkakgiltcrsksclgsimtpksltrgprdkptppdellpq
    aiefvnqyygsfkeakieehlarveavtkeiettgtyqltgdelifatkqawrnaprcig
    riqwsnlqvfdarscstaremfehicrhvrystnngnirsaitvfpqrsdgkhdfrvwna
    qliryagyqmpdgsirgdpanveftqlcidlgwkpkygrfdvvplvlqangrdpelfeip
    pdlvlevamehpkyewfrelelkwyalpavanmllevgglefpgcpfngwymgteigvrd
    fcdvqrynileevgrrmglethklaslwkdqavveiniavlhsfqkqnvtimdhhsaaes
    fmkymqneyrsrggcpadwiwlvppmsgsitpvfhqemlnyvlspfyyyqveawkthvwq
    d
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3e7gB (B:)
    prhvriknwgsgmtfqdtlhhkakgiltcrsksclgsimtpksltrgprdkptppdellp
    qaiefvnqyygsfkeakieehlarveavtkeiettgtyqltgdelifatkqawrnaprci
    griqwsnlqvfdarscstaremfehicrhvrystnngnirsaitvfpqrsdgkhdfrvwn
    aqliryagyqmpdgsirgdpanveftqlcidlgwkpkygrfdvvplvlqangrdpelfei
    ppdlvlevamehpkyewfrelelkwyalpavanmllevgglefpgcpfngwymgteigvr
    dfcdvqrynileevgrrmglethklaslwkdqavveiniavlhsfqkqnvtimdhhsaae
    sfmkymqneyrsrggcpadwiwlvppmsgsitpvfhqemlnyvlspfyyyqveawkthvw
    qdek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e7gB (B:)
    rhvriknwgsgmtfqdtlhhkakgiltcrsksclgsimtpksltrgprdkptppdellpq
    aiefvnqyygsfkeakieehlarveavtkeiettgtyqltgdelifatkqawrnaprcig
    riqwsnlqvfdarscstaremfehicrhvrystnngnirsaitvfpqrsdgkhdfrvwna
    qliryagyqmpdgsirgdpanveftqlcidlgwkpkygrfdvvplvlqangrdpelfeip
    pdlvlevamehpkyewfrelelkwyalpavanmllevgglefpgcpfngwymgteigvrd
    fcdvqrynileevgrrmglethklaslwkdqavveiniavlhsfqkqnvtimdhhsaaes
    fmkymqneyrsrggcpadwiwlvppmsgsitpvfhqemlnyvlspfyyyqveawkthvwq
    d
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3e7gC (C:)
    prhvriknwgsgmtfqdtlhhkakgiltcrsksclgsimtpksltrgprdkptppdellp
    qaiefvnqyygsfkeakieehlarveavtkeiettgtyqltgdelifatkqawrnaprci
    griqwsnlqvfdarscstaremfehicrhvrystnngnirsaitvfpqrsdgkhdfrvwn
    aqliryagyqmpdgsirgdpanveftqlcidlgwkpkygrfdvvplvlqangrdpelfei
    ppdlvlevamehpkyewfrelelkwyalpavanmllevgglefpgcpfngwymgteigvr
    dfcdvqrynileevgrrmglethklaslwkdqavveiniavlhsfqkqnvtimdhhsaae
    sfmkymqneyrsrggcpadwiwlvppmsgsitpvfhqemlnyvlspfyyyqveawkthvw
    qdek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e7gC (C:)
    rhvriknwgsgmtfqdtlhhkakgiltcrsksclgsimtpksltrgprdkptppdellpq
    aiefvnqyygsfkeakieehlarveavtkeiettgtyqltgdelifatkqawrnaprcig
    riqwsnlqvfdarscstaremfehicrhvrystnngnirsaitvfpqrsdgkhdfrvwna
    qliryagyqmpdgsirgdpanveftqlcidlgwkpkygrfdvvplvlqangrdpelfeip
    pdlvlevamehpkyewfrelelkwyalpavanmllevgglefpgcpfngwymgteigvrd
    fcdvqrynileevgrrmglethklaslwkdqavveiniavlhsfqkqnvtimdhhsaaes
    fmkymqneyrsrggcpadwiwlvppmsgsitpvfhqemlnyvlspfyyyqveawkthvwq
    dek
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3e7gD (D:)
    prhvriknwgsgmtfqdtlhhkakgiltcrsksclgsimtpksltrgprdkptppdellp
    qaiefvnqyygsfkeakieehlarveavtkeiettgtyqltgdelifatkqawrnaprci
    griqwsnlqvfdarscstaremfehicrhvrystnngnirsaitvfpqrsdgkhdfrvwn
    aqliryagyqmpdgsirgdpanveftqlcidlgwkpkygrfdvvplvlqangrdpelfei
    ppdlvlevamehpkyewfrelelkwyalpavanmllevgglefpgcpfngwymgteigvr
    dfcdvqrynileevgrrmglethklaslwkdqavveiniavlhsfqkqnvtimdhhsaae
    sfmkymqneyrsrggcpadwiwlvppmsgsitpvfhqemlnyvlspfyyyqveawkthvw
    qdek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e7gD (D:)
    rhvriknwgsgmtfqdtlhhkakgiltcrsksclgsimtpksltrgprdkptppdellpq
    aiefvnqyygsfkeakieehlarveavtkeiettgtyqltgdelifatkqawrnaprcig
    riqwsnlqvfdarscstaremfehicrhvrystnngnirsaitvfpqrsdgkhdfrvwna
    qliryagyqmpdgsirgdpanveftqlcidlgwkpkygrfdvvplvlqangrdpelfeip
    pdlvlevamehpkyewfrelelkwyalpavanmllevgglefpgcpfngwymgteigvrd
    fcdvqrynileevgrrmglethklaslwkdqavveiniavlhsfqkqnvtimdhhsaaes
    fmkymqneyrsrggcpadwiwlvppmsgsitpvfhqemlnyvlspfyyyqveawkthvwq
    d