PDB entry 3e77

View 3e77 on RCSB PDB site
Description: Human phosphoserine aminotransferase in complex with PLP
Class: transferase
Keywords: Phosphoserine aminotransferase, SERC, PLP, Structural Genomics, Structural Genomics Consortium, SGC, Amino-acid biosynthesis, Aminotransferase, Disease mutation, Pyridoxal phosphate, Serine biosynthesis, Transferase
Deposited on 2008-08-18, released 2008-08-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.199
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoserine aminotransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: PSAT1, PSA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y617 (23-376)
      • expression tag (14-22)
    Domains in SCOPe 2.07: d3e77a1, d3e77a2
  • Chain 'B':
    Compound: phosphoserine aminotransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: PSAT1, PSA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y617 (23-376)
      • expression tag (15-22)
    Domains in SCOPe 2.07: d3e77b1, d3e77b2
  • Chain 'C':
    Compound: phosphoserine aminotransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: PSAT1, PSA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y617 (23-End)
      • expression tag (14-22)
    Domains in SCOPe 2.07: d3e77c1, d3e77c2
  • Heterogens: PLP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3e77A (A:)
    mhhhhhhssgvdlgtenlyfqsmlphsvlleiqkelldykgvgisvlemshrssdfakii
    nntenlvrellavpdnykviflqgggcgqfsavplnliglkagrcadyvvtgawsakaae
    eakkfgtinivhpklgsytkipdpstwnlnpdasyvyycanetvhgvefdfipdvkgavl
    vcdmssnflskpvdvskfgvifagaqknvgsagvtvvivrddllgfalrecpsvleykvq
    agnsslyntppcfsiyvmglvlewiknnggaaameklssiksqtiyeiidnsqgfyvcpv
    epqnrskmnipfrignakgddalekrfldkalelnmlslkghrsvggiraslynavtied
    vqklaafmkkflemhql
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e77A (A:)
    tenlyfqsmlphsvlleiqkelldykgvgisvlemshrssdfakiinntenlvrellavp
    dnykviflqgggcgqfsavplnliglkagrcadyvvtgawsakaaeeakkfgtinivhpk
    lgsytkipdpstwnlnpdasyvyycanetvhgvefdfipdvkgavlvcdmssnflskpvd
    vskfgvifagaqknvgsagvtvvivrddllgfalrecpsvleykvqagnsslyntppcfs
    iyvmglvlewiknnggaaameklssiksqtiyeiidnsqgfyvcpvepqnrskmnipfri
    gnakgddalekrfldkalelnmlslkghrsvggiraslynavtiedvqklaafmkkflem
    hql
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3e77B (B:)
    mhhhhhhssgvdlgtenlyfqsmlphsvlleiqkelldykgvgisvlemshrssdfakii
    nntenlvrellavpdnykviflqgggcgqfsavplnliglkagrcadyvvtgawsakaae
    eakkfgtinivhpklgsytkipdpstwnlnpdasyvyycanetvhgvefdfipdvkgavl
    vcdmssnflskpvdvskfgvifagaqknvgsagvtvvivrddllgfalrecpsvleykvq
    agnsslyntppcfsiyvmglvlewiknnggaaameklssiksqtiyeiidnsqgfyvcpv
    epqnrskmnipfrignakgddalekrfldkalelnmlslkghrsvggiraslynavtied
    vqklaafmkkflemhql
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e77B (B:)
    enlyfqsmlphsvlleiqkelldykgvgisvlemshrssdfakiinntenlvrellavpd
    nykviflqgggcgqfsavplnliglkagrcadyvvtgawsakaaeeakkfgtinivhpkl
    gsytkipdpstwnlnpdasyvyycanetvhgvefdfipdvkgavlvcdmssnflskpvdv
    skfgvifagaqknvgsagvtvvivrddllgfalrecpsvleykvqagnsslyntppcfsi
    yvmglvlewiknnggaaameklssiksqtiyeiidnsqgfyvcpvepqnrskmnipfrig
    nakgddalekrfldkalelnmlslkghrsvggiraslynavtiedvqklaafmkkflemh
    ql
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3e77C (C:)
    mhhhhhhssgvdlgtenlyfqsmlphsvlleiqkelldykgvgisvlemshrssdfakii
    nntenlvrellavpdnykviflqgggcgqfsavplnliglkagrcadyvvtgawsakaae
    eakkfgtinivhpklgsytkipdpstwnlnpdasyvyycanetvhgvefdfipdvkgavl
    vcdmssnflskpvdvskfgvifagaqknvgsagvtvvivrddllgfalrecpsvleykvq
    agnsslyntppcfsiyvmglvlewiknnggaaameklssiksqtiyeiidnsqgfyvcpv
    epqnrskmnipfrignakgddalekrfldkalelnmlslkghrsvggiraslynavtied
    vqklaafmkkflemhql
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e77C (C:)
    tenlyfqsmlphsvlleiqkelldykgvgisvlemshrssdfakiinntenlvrellavp
    dnykviflqgggcgqfsavplnliglkagrcadyvvtgawsakaaeeakkfgtinivhpk
    lgsytkipdpstwnlnpdasyvyycanetvhgvefdfipdvkgavlvcdmssnflskpvd
    vskfgvifagaqknvgsagvtvvivrddllgfalrecpsvleykvqagnsslyntppcfs
    iyvmglvlewiknnggaaameklssiksqtiyeiidnsqgfyvcpvepqnrskmnipfri
    gnakgddalekrfldkalelnmlslkghrsvggiraslynavtiedvqklaafmkkflem
    hq