PDB entry 3e6z

View 3e6z on RCSB PDB site
Description: 1.0 a structure of cusf-w44a-cu(ii) residues 10-88 from escherichia coli
Deposited on 2008-08-17, released 2009-07-07
The last revision was dated 2021-10-20, with a file datestamp of 2021-10-15.
Experiment type: XRAY
Resolution: 1 Å
R-factor: N/A
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Cation efflux system protein cusF
    Species: ESCHERICHIA COLI [TaxId:562]
    Gene: cusF, cusX, ylcC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77214 (1-79)
      • initiating methionine (0)
      • engineered mutation (35)
  • Heterogens: CU, ACT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records:
    >3e6zX (X:)
meaqpqvisatgvvkgidleskkitihhdpiaavnapemtmrftitpqtkmseiktgdkv
afnfvqqgnlsllqdikvsq