PDB entry 3e6o

View 3e6o on RCSB PDB site
Description: Structure of murine INOS oxygenase domain with inhibitor AR-C124355
Class: oxidoreductase
Keywords: nitric oxide, NOS, HEME, tetrahydrobiopterin, oxidoreductase, Calmodulin-binding, FAD, FMN, Iron, Metal-binding, NADP, Polymorphism, Zinc
Deposited on 2008-08-15, released 2008-10-07
The last revision prior to the SCOP 1.75 freeze date was dated 2009-01-20, with a file datestamp of 2009-01-16.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.229
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitric oxide synthase, inducible
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3e6oa1
  • Chain 'B':
    Compound: Nitric oxide synthase, inducible
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3e6ob1
  • Heterogens: HEM, H4B, A55, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3e6oA (A:)
    ldklhvtstrpqyvriknwgsgeilhdtlhhkatsdftcksksclgsimnpksltrgprd
    kptpleellphaiefinqyygsfkeakieehlarleavtkeiettgtyqltldelifatk
    mawrnaprcigriqwsnlqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrs
    dgkhdfrlwnsqliryagyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqa
    dgqdpevfeippdlvlevtmehpkyewfqelglkwyalpavanmllevgglefpacpfng
    wymgteigvrdfcdtqrynileevgrrmglethtlaslwkdravteinvavlhsfqkqnv
    timdhhtasesfmkhmqneyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyy
    qiepwkthiwqne
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e6oA (A:)
    qyvriknwgsgeilhdtlhhkatsdftsclgsimnpksltrgprdkptpleellphaief
    inqyygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcigriqw
    snlqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwnsqlir
    yagyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeippdlv
    levtmehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrdfcdt
    qrynileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtasesfmkh
    mqneyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3e6oB (B:)
    ldklhvtstrpqyvriknwgsgeilhdtlhhkatsdftcksksclgsimnpksltrgprd
    kptpleellphaiefinqyygsfkeakieehlarleavtkeiettgtyqltldelifatk
    mawrnaprcigriqwsnlqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrs
    dgkhdfrlwnsqliryagyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqa
    dgqdpevfeippdlvlevtmehpkyewfqelglkwyalpavanmllevgglefpacpfng
    wymgteigvrdfcdtqrynileevgrrmglethtlaslwkdravteinvavlhsfqkqnv
    timdhhtasesfmkhmqneyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyy
    qiepwkthiwqne
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e6oB (B:)
    qyvriknwgsgeilhdtlhhkatclgsimnpksltrgprdkptpleellphaiefinqyy
    gsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcigriqwsnlqv
    fdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwnsqliryagyq
    mpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeippdlvlevtm
    ehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrdfcdtqryni
    leevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtasesfmkhmqney
    rarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiw