PDB entry 3e6l

View 3e6l on RCSB PDB site
Description: Structure of murine INOS oxygenase domain with inhibitor AR-C132283
Class: oxidoreductase
Keywords: nitric oxide, NOS, HEME, tetrahydrobiopterin, oxidoreductase, Calmodulin-binding, FAD, FMN, Iron, Metal-binding, NADP, Polymorphism, Zinc
Deposited on 2008-08-15, released 2008-10-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-01-20, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.219
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitric oxide synthase, inducible
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3e6la_
  • Chain 'B':
    Compound: Nitric oxide synthase, inducible
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3e6lb_
  • Heterogens: BOG, SO4, HEM, H4B, A11, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3e6lA (A:)
    ldklhvtstrpqyvriknwgsgeilhdtlhhkatsdftcksksclgsimnpksltrgprd
    kptpleellphaiefinqyygsfkeakieehlarleavtkeiettgtyqltldelifatk
    mawrnaprcigriqwsnlqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrs
    dgkhdfrlwnsqliryagyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqa
    dgqdpevfeippdlvlevtmehpkyewfqelglkwyalpavanmllevgglefpacpfng
    wymgteigvrdfcdtqrynileevgrrmglethtlaslwkdravteinvavlhsfqkqnv
    timdhhtasesfmkhmqneyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyy
    qiepwkthiwqne
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e6lA (A:)
    qyvriknwgsgeilhdtlhhkatssclgsimnpksltrgprdkptpleellphaiefinq
    yygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcigriqwsnl
    qvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwnsqliryag
    yqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeippdlvlev
    tmehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrdfcdtqry
    nileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtasesfmkhmqn
    eyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiwq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3e6lB (B:)
    ldklhvtstrpqyvriknwgsgeilhdtlhhkatsdftcksksclgsimnpksltrgprd
    kptpleellphaiefinqyygsfkeakieehlarleavtkeiettgtyqltldelifatk
    mawrnaprcigriqwsnlqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrs
    dgkhdfrlwnsqliryagyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqa
    dgqdpevfeippdlvlevtmehpkyewfqelglkwyalpavanmllevgglefpacpfng
    wymgteigvrdfcdtqrynileevgrrmglethtlaslwkdravteinvavlhsfqkqnv
    timdhhtasesfmkhmqneyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyy
    qiepwkthiwqne
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e6lB (B:)
    qyvriknwgsgeilhdtlhhkatssclgsimnpksltrgprdkptpleellphaiefinq
    yygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcigriqwsnl
    qvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwnsqliryag
    yqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeippdlvlev
    tmehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrdfcdtqry
    nileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtasesfmkhmqn
    eyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiwq