PDB entry 3e6g

View 3e6g on RCSB PDB site
Description: Crystal structure of XometC, a cystathionine c-lyase-like protein from Xanthomonas oryzae pv.oryzae
Class: lyase
Keywords: Bacterial blight, cystathionine lyase, reverse transsulfuration pathway, Xanthomonas oryzae pv.oryzae, Lyase
Deposited on 2008-08-15, released 2009-08-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-08-18, with a file datestamp of 2009-08-14.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.22
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cystathionine gamma-lyase-like protein
    Species: Xanthomonas oryzae pv. oryzae [TaxId:64187]
    Gene: metB, XOO0778
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e6ga_
  • Chain 'B':
    Compound: Cystathionine gamma-lyase-like protein
    Species: Xanthomonas oryzae pv. oryzae [TaxId:64187]
    Gene: metB, XOO0778
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e6gb_
  • Chain 'C':
    Compound: Cystathionine gamma-lyase-like protein
    Species: Xanthomonas oryzae pv. oryzae [TaxId:64187]
    Gene: metB, XOO0778
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e6gc_
  • Chain 'D':
    Compound: Cystathionine gamma-lyase-like protein
    Species: Xanthomonas oryzae pv. oryzae [TaxId:64187]
    Gene: metB, XOO0778
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e6gd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3e6gA (A:)
    gshmsnrtthshdgdralslatlaihggqspdpstgavmppiyatstyaqsspgehqgfe
    ysrthnptrfayercvaaleggtrafafasgmaatstvmelldagshvvamddlyggtfr
    lfervrrrtagldfsfvdltdpaafkaairadtkmvwietptnpmlklvdiaaiaviark
    hglltvvdntfaspmlqrplslgadlvvhsatkylnghsdmvggiavvgdnaelaeqmaf
    lqnsiggvqgpfdsflalrglktlplrmrahcenalalaqwlethpaiekviypglashp
    qhvlakrqmsgfggivsivlkggfdaakrfcektelftlaeslggveslvnhpavmthas
    ipvarreqlgisdalvrlsvgiedlgdlrgdleralvnqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e6gA (A:)
    alslatlaihggqspdpstgavmppiyatstyaqssthnptrfayercvaaleggtrafa
    fasgmaatstvmelldagshvvamddlyggtfrlfervrrrtagldfsfvdltdpaafka
    airadtkmvwietptnpmlklvdiaaiaviarkhglltvvdntfaspmlqrplslgadlv
    vhsatkylnghsdmvggiavvgdnaelaeqmaflqnsiggvqgpfdsflalrglktlplr
    mrahcenalalaqwlethpaiekviypglashpqhvlakrqmsgfggivsivlkggfdaa
    krfcektelftlaeslggveslvnhpavmthasipvarreqlgisdalvrlsvgiedlgd
    lrgdlera
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3e6gB (B:)
    gshmsnrtthshdgdralslatlaihggqspdpstgavmppiyatstyaqsspgehqgfe
    ysrthnptrfayercvaaleggtrafafasgmaatstvmelldagshvvamddlyggtfr
    lfervrrrtagldfsfvdltdpaafkaairadtkmvwietptnpmlklvdiaaiaviark
    hglltvvdntfaspmlqrplslgadlvvhsatkylnghsdmvggiavvgdnaelaeqmaf
    lqnsiggvqgpfdsflalrglktlplrmrahcenalalaqwlethpaiekviypglashp
    qhvlakrqmsgfggivsivlkggfdaakrfcektelftlaeslggveslvnhpavmthas
    ipvarreqlgisdalvrlsvgiedlgdlrgdleralvnqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e6gB (B:)
    alslatlaihggthnptrfayercvaaleggtrafafasgmaatstvmelldagshvvam
    ddlyggtfrlfervrrrtagldfsfvdltdpaafkaairadtkmvwietptnpmlklvdi
    aaiaviarkhglltvvdntfaspmlqrplslgadlvvhsatkylnghsdmvggiavvgdn
    aelaeqmaflqnsiggvqgpfdsflalrglktlplrmrahcenalalaqwlethpaiekv
    iypglashpqhvlakrqmsgfggivsivlkggfdaakrfcektelftlaeslggveslvn
    hpavmtheqlgisdalvrlsvgiedlgdlrgdlera
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3e6gC (C:)
    gshmsnrtthshdgdralslatlaihggqspdpstgavmppiyatstyaqsspgehqgfe
    ysrthnptrfayercvaaleggtrafafasgmaatstvmelldagshvvamddlyggtfr
    lfervrrrtagldfsfvdltdpaafkaairadtkmvwietptnpmlklvdiaaiaviark
    hglltvvdntfaspmlqrplslgadlvvhsatkylnghsdmvggiavvgdnaelaeqmaf
    lqnsiggvqgpfdsflalrglktlplrmrahcenalalaqwlethpaiekviypglashp
    qhvlakrqmsgfggivsivlkggfdaakrfcektelftlaeslggveslvnhpavmthas
    ipvarreqlgisdalvrlsvgiedlgdlrgdleralvnqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e6gC (C:)
    alslatlaihggqspdpstgavmppiyatstyaqssthnptrfayercvaaleggtrafa
    fasgmaatstvmelldagshvvamddlyggtfrlfervrrrtagldfsfvdltdpaafka
    airadtkmvwietptnpmlklvdiaaiaviarkhglltvvdntfaspmlqrplslgadlv
    vhsatkylnghsdmvggiavvgdnaelaeqmaflqnsiggvqgpfdsflalrglktlplr
    mrahcenalalaqwlethpaiekviypglashpqhvlakrqmsgfggivsivlkggfdaa
    krfcektelftlaeslggveslvnhpavmthasipvarreqlgisdalvrlsvgiedlgd
    lrgdlera
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3e6gD (D:)
    gshmsnrtthshdgdralslatlaihggqspdpstgavmppiyatstyaqsspgehqgfe
    ysrthnptrfayercvaaleggtrafafasgmaatstvmelldagshvvamddlyggtfr
    lfervrrrtagldfsfvdltdpaafkaairadtkmvwietptnpmlklvdiaaiaviark
    hglltvvdntfaspmlqrplslgadlvvhsatkylnghsdmvggiavvgdnaelaeqmaf
    lqnsiggvqgpfdsflalrglktlplrmrahcenalalaqwlethpaiekviypglashp
    qhvlakrqmsgfggivsivlkggfdaakrfcektelftlaeslggveslvnhpavmthas
    ipvarreqlgisdalvrlsvgiedlgdlrgdleralvnqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e6gD (D:)
    alslatlaihgthnptrfayercvaaleggtrafafasgmaatstvmelldagshvvamd
    dlyggtfrlfervrrrtagldfsfvdltdpaafkaairadtkmvwietptnpmlklvdia
    aiaviarkhglltvvdntfaspmlqrplslgadlvvhsatkylnghsdmvggiavvgdna
    elaeqmaflqnsiggvqgpfdsflalrglktlplrmrahcenalalaqwlethpaiekvi
    ypglashpqhvlakrqmsgfggivsivlkggfdaakrfcektelftlaeslggveslvnh
    pavmtreqlgisdalvrlsvgiedlgdlrgdlera