PDB entry 3e6f

View 3e6f on RCSB PDB site
Description: MHC CLASS I H-2Dd Heavy chain complexed with Beta-2 Microglobulin and a variant peptide, PA9, from the Human immunodeficiency virus (BaL) envelope glycoprotein 120
Class: immune system
Keywords: COMPLEX (HISTOCOMPATIBILITY/ANTIGEN), Glycoprotein, Immune response, Membrane, MHC I, Phosphoprotein, Transmembrane, Immunoglobulin domain, Secreted, Envelope protein, IMMUNE SYSTEM
Deposited on 2008-08-15, released 2009-08-18
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-08-18, with a file datestamp of 2009-08-14.
Experiment type: XRAY
Resolution: 2.41 Å
R-factor: 0.223
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: H-2 class I histocompatibility antigen, D-D alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: H2-D1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: beta-2 microglobulin
    Species: Mus musculus [TaxId:10090]
    Gene: B2m, RP23-34E24.5-001
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91XJ8 (0-98)
      • engineered (0)
    Domains in SCOPe 2.02: d3e6fb_
  • Chain 'P':
    Compound: Envelope glycoprotein 9-residue peptide
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: ENV
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e6fB (B:)
    mqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhasmaepktvywdrdm
    

  • Chain 'P':
    No sequence available.