PDB entry 3e6d

View 3e6d on RCSB PDB site
Description: Crystal Structure of CprK C200S
Class: transcription regulation
Keywords: CprK, Halorespiration, transcriptional regulator, TRANSCRIPTION REGULATION
Deposited on 2008-08-15, released 2008-09-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2008-12-23, with a file datestamp of 2009-02-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.233
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cyclic nucleotide-binding protein
    Species: Desulfitobacterium hafniense [TaxId:272564]
    Gene: Dhaf_0678
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q18R04
      • engineered (199)
    Domains in SCOPe 2.06: d3e6da1, d3e6da2
  • Chain 'B':
    Compound: Cyclic nucleotide-binding protein
    Species: Desulfitobacterium hafniense [TaxId:272564]
    Gene: Dhaf_0678
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q18R04
      • engineered (199)
    Domains in SCOPe 2.06: d3e6db1, d3e6db2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3e6dA (A:)
    msveglgkdfcgaiipdnffpieklrnytqmglirdfakgsavimpgeeitsmiflvegk
    ikldiifedgsekllyyaggnsligklyptgnniyatameptrtcwfsekslrtvfrtde
    dmifeifknyltkvayyarqvaemntynptirilrlfyelcssqgkrvgdtyeitmplsq
    ksigeitgvhhvtvsrvlaslkrenildkkknkiivynlgelkhlseqtsyysdpnsssv
    dklaaaldhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e6dA (A:)
    nffpieklrnytqmglirdfakgsavimpgeeitsmiflvegkikldiifedgsekllyy
    aggnsligklyptgnniyatameptrtcwfsekslrtvfrtdedmifeifknyltkvayy
    arqvptirilrlfyelcssqgkrvgdtyeitmplsqksigeitgvhhvtvsrvlaslkre
    nildkkknkiivynlgelkhls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3e6dB (B:)
    msveglgkdfcgaiipdnffpieklrnytqmglirdfakgsavimpgeeitsmiflvegk
    ikldiifedgsekllyyaggnsligklyptgnniyatameptrtcwfsekslrtvfrtde
    dmifeifknyltkvayyarqvaemntynptirilrlfyelcssqgkrvgdtyeitmplsq
    ksigeitgvhhvtvsrvlaslkrenildkkknkiivynlgelkhlseqtsyysdpnsssv
    dklaaaldhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e6dB (B:)
    ffpieklrnytqmglirdfakgsavimpgeeitsmiflvegkikldiifedgsekllyya
    ggnsligklyptgnniyatameptrtcwfsekslrtvfrtdedmifeifknyltkvayya
    rqvptirilrlfyelcssqgkrvgdtyeitmplsqksigeitgvhhvtvsrvlaslkren
    ildkkknkiivynlgelkhlseq