PDB entry 3e6c

View 3e6c on RCSB PDB site
Description: CprK OCPA DNA Complex
Class: transcription regulation/DNA
Keywords: CprK, Halorespiration, transcriptional regulator, TRANSCRIPTION REGULATION-DNA COMPLEX
Deposited on 2008-08-15, released 2008-09-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.219
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA (5'-d(p*dgp*dgp*dcp*dap*dtp*dgp*dtp*dtp*dap*dap*dtp*dgp*dc)-3')
  • Chain 'B':
    Compound: DNA (5'-d(p*dgp*dcp*dap*dtp*dtp*dap*dap*dcp*dap*dtp*dgp*dcp*dc)-3')
  • Chain 'C':
    Compound: Cyclic nucleotide-binding protein
    Species: Desulfitobacterium hafniense [TaxId:272564]
    Gene: Dhaf_0678
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q18R04 (Start-231)
      • engineered (199)
      • expression tag (232)
    Domains in SCOPe 2.07: d3e6cc1, d3e6cc2, d3e6cc3
  • Heterogens: 3C4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3e6cC (C:)
    msveglgkdfcgaiipdnffpieklrnytqmglirdfakgsavimpgeeitsmiflvegk
    ikldiifedgsekllyyaggnsligklyptgnniyatameptrtcwfsekslrtvfrtde
    dmifeifknyltkvayyarqvaemntynptirilrlfyelcssqgkrvgdtyeitmplsq
    ksigeitgvhhvtvsrvlaslkrenildkkknkiivynlgelkhlseqtsyysdpnsssv
    dklaaaldhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e6cC (C:)
    dfcgaiipdnffpieklrnytqmglirdfakgsavimpgeeitsmiflvegkikldiife
    dgsekllyyaggnsligklyptgnniyatameptrtcwfsekslrtvfrtdedmifeifk
    nyltkvayyarqvaemntynptirilrlfyelcssqgkrvgdtyeitmplsqksigeitg
    vhhvtvsrvlaslkrenildkkknkiivynlgelkhlseqtsyys