PDB entry 3e66

View 3e66 on RCSB PDB site
Description: Crystal structure of the beta-finger domain of yeast Prp8
Class: splicing
Keywords: beta-finger, RNase H fold, mRNA processing, mRNA splicing, Nucleus, RNA-binding protein, Spliceosome, spliceosomal protein
Deposited on 2008-08-14, released 2008-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.214
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: prp8
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: PRP8, DBF3, DNA39, RNA8, SLT21, USA2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e66a1
  • Chain 'B':
    Compound: prp8
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: PRP8, DBF3, DNA39, RNA8, SLT21, USA2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e66b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3e66A (A:)
    gplgspefglqiyqssvqepflnssnyaelfnndiklfvddtnvyrvtvhktfegnvatk
    aingciftlnpktghlflkiihtsvwagqkrlsqlakwktaeevsalvrslpkeeqpkqi
    ivtrkamldplevhmldfpniairptelrlpfsaamsidklsdvvmkatepqmvlfniyd
    dwldrissytafsrltlllralktneesakmillsdptitiksyhlwpsftdeqwities
    qmrdlilteygrkynvnisaltqteikdiilgqnikapsvkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e66A (A:)
    pflnssnyaelfnndiklfvddtnvyrvtvhktfegnvatkaingciftlnpktghlflk
    iihtsvwagqkrlsqlakwktaeevsalvrslpkeeqpkqiivtrkamldplevhmldfp
    niairptelrlpfsaamsidklsdvvmkatepqmvlfniyddwldrissytafsrltlll
    ralktneesakmillsdptitiksyhlwpsftdeqwitiesqmrdlilteygrkynvnis
    altqteikdiilgqn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3e66B (B:)
    gplgspefglqiyqssvqepflnssnyaelfnndiklfvddtnvyrvtvhktfegnvatk
    aingciftlnpktghlflkiihtsvwagqkrlsqlakwktaeevsalvrslpkeeqpkqi
    ivtrkamldplevhmldfpniairptelrlpfsaamsidklsdvvmkatepqmvlfniyd
    dwldrissytafsrltlllralktneesakmillsdptitiksyhlwpsftdeqwities
    qmrdlilteygrkynvnisaltqteikdiilgqnikapsvkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e66B (B:)
    pflnssnyaelfnndiklfvddtnvyrvtvhktfegnvatkaingciftlnpktghlflk
    iihtsvwagqkrlsqlakwktaeevsalvrslpkeeqpkqiivtrkamldplevhmldfp
    niairptelrlpfsaamsidklsdvvmkatepqmvlfniyddwldrissytafsrltlll
    ralktneesakmillsdptitiksyhlwpsftdeqwitiesqmrdlilteygrkynvnis
    altqteikdiilgqn