PDB entry 3e64

View 3e64 on RCSB PDB site
Description: Fragment based discovery of JAK-2 inhibitors
Class: transferase
Keywords: DRUG DISCOVERY, JAK2, FRAGMENT BASED, ATP-binding, Disease mutation, Kinase, Membrane, Nucleotide-binding, Phosphoprotein, Proto-oncogene, SH2 domain, Transferase, Tyrosine-protein kinase
Deposited on 2008-08-14, released 2008-10-14
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-02-08, with a file datestamp of 2012-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.172
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase JAK2
    Species: Homo sapiens [TaxId:9606]
    Gene: JAK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3e64a_
  • Heterogens: 5B3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e64A (A:)
    rdptqfeerhlkflqqlgkgnfgsvemcrydplqdntgevvavkklqhsteehlrdfere
    ieilkslqhdnivkykgvcysagrrnlklimeylpygslrdylqkhkeridhikllqyts
    qickgmeylgtkryihrdlatrnilvenenrvkigdfgltkvlpqdkeyykvkepgespi
    fwyapeslteskfsvasdvwsfgvvlyelftyieksksppaefmrmigndkqgqmivfhl
    iellknngrlprpdgcpdeiymimtecwnnnvnqrpsfrdlalrvdqirdnma