PDB entry 3e5u

View 3e5u on RCSB PDB site
Description: OCPA complexed CprK (C200S)
Class: transcription regulation
Keywords: CprK, Halorespiration, transcriptional regulator, TRANSCRIPTION REGULATION
Deposited on 2008-08-14, released 2008-09-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: 0.185
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cyclic nucleotide-binding protein
    Species: Desulfitobacterium hafniense [TaxId:272564]
    Gene: Dhaf_0678
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q18R04
      • engineered (199)
    Domains in SCOPe 2.07: d3e5ua1, d3e5ua2
  • Chain 'B':
    Compound: Cyclic nucleotide-binding protein
    Species: Desulfitobacterium hafniense [TaxId:272564]
    Gene: Dhaf_0678
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q18R04
      • engineered (199)
    Domains in SCOPe 2.07: d3e5ub1, d3e5ub2
  • Chain 'C':
    Compound: Cyclic nucleotide-binding protein
    Species: Desulfitobacterium hafniense [TaxId:272564]
    Gene: Dhaf_0678
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q18R04
      • engineered (199)
    Domains in SCOPe 2.07: d3e5uc1, d3e5uc2
  • Chain 'D':
    Compound: Cyclic nucleotide-binding protein
    Species: Desulfitobacterium hafniense [TaxId:272564]
    Gene: Dhaf_0678
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q18R04
      • engineered (199)
    Domains in SCOPe 2.07: d3e5ud1, d3e5ud2
  • Heterogens: 3C4, PO4, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3e5uA (A:)
    msveglgkdfcgaiipdnffpieklrnytqmglirdfakgsavimpgeeitsmiflvegk
    ikldiifedgsekllyyaggnsligklyptgnniyatameptrtcwfsekslrtvfrtde
    dmifeifknyltkvayyarqvaemntynptirilrlfyelcssqgkrvgdtyeitmplsq
    ksigeitgvhhvtvsrvlaslkrenildkkknkiivynlgelkhlseqtsyysdpnsssv
    dklaaaldhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e5uA (A:)
    dfcgaiipdnffpieklrnytqmglirdfakgsavimpgeeitsmiflvegkikldiife
    dgsekllyyaggnsligklyptgnniyatameptrtcwfsekslrtvfrtdedmifeifk
    nyltkvayyarqvaemntynptirilrlfyelcssqgkrvgdtyeitmplsqksigeitg
    vhhvtvsrvlaslkrenildkiivynlgelkhlse
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3e5uB (B:)
    msveglgkdfcgaiipdnffpieklrnytqmglirdfakgsavimpgeeitsmiflvegk
    ikldiifedgsekllyyaggnsligklyptgnniyatameptrtcwfsekslrtvfrtde
    dmifeifknyltkvayyarqvaemntynptirilrlfyelcssqgkrvgdtyeitmplsq
    ksigeitgvhhvtvsrvlaslkrenildkkknkiivynlgelkhlseqtsyysdpnsssv
    dklaaaldhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e5uB (B:)
    dfcgaiipdnffpieklrnytqmglirdfakgsavimpgeeitsmiflvegkikldiife
    dgsekllyyaggnsligklyptgnniyatameptrtcwfsekslrtvfrtdedmifeifk
    nyltkvayyarqvaemntynptirilrlfyelcssqgkrvgdtyeitmplsqksigeitg
    vhhvtvsrvlaslkrenildkkknkiivynlgelkhls
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3e5uC (C:)
    msveglgkdfcgaiipdnffpieklrnytqmglirdfakgsavimpgeeitsmiflvegk
    ikldiifedgsekllyyaggnsligklyptgnniyatameptrtcwfsekslrtvfrtde
    dmifeifknyltkvayyarqvaemntynptirilrlfyelcssqgkrvgdtyeitmplsq
    ksigeitgvhhvtvsrvlaslkrenildkkknkiivynlgelkhlseqtsyysdpnsssv
    dklaaaldhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e5uC (C:)
    dfcgaiipdnffpieklrnytqmglirdfakgsavimpgeeitsmiflvegkikldiife
    dgsekllyyaggnsligklyptgnniyatameptrtcwfsekslrtvfrtdedmifeifk
    nyltkvayyarqvaemntynptirilrlfyelcssqgkrvgdtyeitmplsqksigeitg
    vhhvtvsrvlaslkrenildkkknkiivynlgelkhlse
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3e5uD (D:)
    msveglgkdfcgaiipdnffpieklrnytqmglirdfakgsavimpgeeitsmiflvegk
    ikldiifedgsekllyyaggnsligklyptgnniyatameptrtcwfsekslrtvfrtde
    dmifeifknyltkvayyarqvaemntynptirilrlfyelcssqgkrvgdtyeitmplsq
    ksigeitgvhhvtvsrvlaslkrenildkkknkiivynlgelkhlseqtsyysdpnsssv
    dklaaaldhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e5uD (D:)
    dfcgaiipdnffpieklrnytqmglirdfakgsavimpgeeitsmiflvegkikldiife
    dgsekllyyaggnsligklyptgnniyatameptrtcwfsekslrtvfrtdedmifeifk
    nyltkvayyarqvaemntynptirilrlfyelcssqgkrvgdtyeitmplsqksigeitg
    vhhvtvsrvlaslkrenildkkknkiivynlgelkhlseq