PDB entry 3e5j

View 3e5j on RCSB PDB site
Description: Crystal structure of CYP105P1 wild-type ligand-free form
Class: oxidoreductase
Keywords: P450, OXIDOREDUCTASE, Heme, Iron, Metal-binding, Monooxygenase
Deposited on 2008-08-14, released 2008-12-30
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.191
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P450 (Cytochrome P450 hydroxylase)
    Species: Streptomyces avermitilis [TaxId:33903]
    Gene: pteC, SAV413, SAV_413
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93H81 (Start-398)
      • engineered (386)
      • expression tag (399)
    Domains in SCOPe 2.03: d3e5ja_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3e5jA (A:)
    mpeptadaptvpkarscpflppdgiadiraaapvtratftsgheawlvtgyeevrallrd
    ssfsvqvphalhtqdgvvtqkpgrgsllwqdepehtsdrkllakeftvrrmqalrpniqr
    ivdehldaiearggpvdlvktfanavpsmvisdlfgvpverraefqdiaeammrvdqdaa
    ateaagmrlggllyqlvqerranpgddlisalittedpdgvvddmflmnaagtlliaahd
    ttacmiglgtallldspdqlallredpslvgnaveellryltigqfggervatrdvelgg
    vriakgeqvvahvlaadfdpafveeperfditrrpaphlafgfgahqcigqqlarielqi
    vfetlfrrlpglrlakpveelrfrhdivfygvhelpvtwhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e5jA (A:)
    daptvpkarscpflppdgiadiraaapvtratftsgheawlvtgyeevrallrdssfsvq
    vphalhtqdgvvgrgsllwqdepehtsdrkllakeftvrrmqalrpniqrivdehldaie
    arggpvdlvktfanavpsmvisdlfgvpverraefqdiaeammrvdqdaaateaagmrlg
    gllyqlvqerranpgddlisalittedpdgvvddmflmnaagtlliaahdttacmiglgt
    allldspdqlallredpslvgnaveellryltigqfggervatrdvelggvriakgeqvv
    ahvlaadfdpafveeperfditrrpaphlafgfgahqcigqqlarielqivfetlfrrlp
    glrlakpveelrfrhdivfygvhelpvtwh