PDB entry 3e5h

View 3e5h on RCSB PDB site
Description: Crystal Structure of Rab28 GTPase in the Active (GppNHp-bound) Form
Class: signaling protein
Keywords: Rab GTPase, SIGNALING PROTEIN, Cell membrane, GTP-binding, Lipoprotein, Membrane, Nucleotide-binding, Prenylation
Deposited on 2008-08-13, released 2008-08-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-28
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB28
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51157 (4-End)
      • expression tag (0-3)
    Domains in SCOPe 2.08: d3e5ha1, d3e5ha2
  • Heterogens: MG, GNP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3e5hA (A:)
    gshmrqlkivvlgdgasgktslttcfaqetfgkqykqtigldfflrritlpgnlnvtlqi
    wdiggqtiggkmldkyiygaqgvllvyditnyqsfenledwytvvkkvseesetqplval
    vgnkidlehmrtikpekhlrfcqengfsshfvsaktgdsvflcfqkvaaeilgiklnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e5hA (A:)
    gshmrqlkivvlgdgasgktslttcfaqetfgkqykqtigldfflrritlpgnlnvtlqi
    wdiggqtiggkmldkyiygaqgvllvyditnyqsfenledwytvvkkvseesetqplval
    vgnkidlehmrtikpekhlrfcqengfsshfvsaktgdsvflcfqkvaaeilgikln