PDB entry 3e58

View 3e58 on RCSB PDB site
Description: Crystal structure of putative beta-phosphoglucomutase from Streptococcus thermophilus
Class: isomerase
Keywords: Streptococcus thermophilus, beta-phosphoglucomutase, Structural Genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, unknown function, ISOMERASE
Deposited on 2008-08-13, released 2008-08-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.171
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative Beta-phosphoglucomutase
    Species: Streptococcus thermophilus LMG 18311 [TaxId:264199]
    Gene: stu0379
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5M5S4 (3-213)
      • engineered (106)
      • engineered (129)
      • engineered (191)
    Domains in SCOPe 2.07: d3e58a_
  • Chain 'B':
    Compound: putative Beta-phosphoglucomutase
    Species: Streptococcus thermophilus LMG 18311 [TaxId:264199]
    Gene: stu0379
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5M5S4 (3-213)
      • expression tag (1-2)
      • engineered (106)
      • engineered (129)
      • engineered (191)
    Domains in SCOPe 2.07: d3e58b1, d3e58b2
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3e58A (A:)
    snamveaiifdmdgvlfdtekyyydrrasflgqkgisidhlppsffiggntkqvwenilr
    deydkwdvstlqeeyntykqnnplpykelifpdvlkvlnevksqgleiglasssvkadif
    raleenrlqgffdivlsgeefkeskpnpeiyltalkqlnvqasraliiedsekgiaagva
    advevwairdnefgmdqsaakglldsltdvldli
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e58A (A:)
    mveaiifdmdgvlfdtekyyydrrasflgqkgisidhlppsffiggntkqvwenilrdey
    dkwdvstlqeeyntykqnnplpykelifpdvlkvlnevksqgleiglasssvkadifral
    eenrlqgffdivlsgeefkeskpnpeiyltalkqlnvqasraliiedsekgiaagvaadv
    evwairdnefgmdqsaakglldsltdvldli
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3e58B (B:)
    snamveaiifdmdgvlfdtekyyydrrasflgqkgisidhlppsffiggntkqvwenilr
    deydkwdvstlqeeyntykqnnplpykelifpdvlkvlnevksqgleiglasssvkadif
    raleenrlqgffdivlsgeefkeskpnpeiyltalkqlnvqasraliiedsekgiaagva
    advevwairdnefgmdqsaakglldsltdvldli
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e58B (B:)
    namveaiifdmdgvlfdtekyyydrrasflgqkgisidhlppsffiqvwenilrdeydkw
    dvstlqeeyntykqnnplpykelifpdvlkvlnevksqgleiglasssvkadifraleen
    rlqgffdivlsgeefkeskpnpeiyltalkqlnvqasraliiedsekgiaagvaadvevw
    airdnefgmdqsaakglldsltdvldli