PDB entry 3e50

View 3e50 on RCSB PDB site
Description: Crystal structure of human insulin degrading enzyme in complex with transforming growth factor-alpha
Class: Hydrolase/Hormone
Keywords: IDE, TGF-ALPHA, Cytoplasm, Hydrolase, Metal-binding, Metalloprotease, Polymorphism, Protease, Zinc, Cell membrane, EGF-like domain, Glycoprotein, Growth factor, Lipoprotein, Membrane, Mitogen, Palmitate, Secreted, Transmembrane, Hydrolase/Hormone COMPLEX
Deposited on 2008-08-12, released 2009-08-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-02-09, with a file datestamp of 2010-02-05.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.193
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Insulin-degrading enzyme
    Species: Homo sapiens [TaxId:9606]
    Gene: hCG_1810909, IDE, RP11-366I13.1-001
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14735
      • engineered (81)
  • Chain 'B':
    Compound: Insulin-degrading enzyme
    Species: Homo sapiens [TaxId:9606]
    Gene: hCG_1810909, IDE, RP11-366I13.1-001
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14735
      • engineered (81)
  • Chain 'C':
    Compound: Protransforming growth factor alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: TGFA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e50c_
  • Chain 'D':
    Compound: Protransforming growth factor alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: TGFA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e50d_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3e50C (C:)
    vvshfndcpdshtqfcfhgtcrflvqedkpacvchsgyvgarcehadlla
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e50C (C:)
    vvshf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3e50D (D:)
    vvshfndcpdshtqfcfhgtcrflvqedkpacvchsgyvgarcehadlla
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e50D (D:)
    vvshfdshtq