PDB entry 3e44

View 3e44 on RCSB PDB site
Description: Q138F HincII bound to cleaved DNA (GTT | AAC) and Mn2+
Class: hydrolase/DNA
Keywords: protein-DNA complex, endonuclease, indirect readout, Hydrolase, Nuclease, Restriction system, HYDROLASE/DNA COMPLEX
Deposited on 2008-08-08, released 2008-08-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-01-20, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.52 Å
R-factor: 0.184
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Type-2 restriction enzyme HindII
    Species: Haemophilus influenzae [TaxId:727]
    Gene: HINDIIR, HI0512
    Database cross-references and differences (RAF-indexed):
    • Uniprot P44413 (0-End)
      • conflict (65)
      • engineered (136)
    Domains in SCOPe 2.08: d3e44a_
  • Chain 'B':
    Compound: Type-2 restriction enzyme HindII
    Species: Haemophilus influenzae [TaxId:727]
    Gene: HINDIIR, HI0512
    Database cross-references and differences (RAF-indexed):
    • Uniprot P44413 (0-End)
      • conflict (65)
      • engineered (136)
    Domains in SCOPe 2.08: d3e44b_
  • Chain 'E':
    Compound: 5'-d(*dgp*dcp*dcp*dgp*dgp*dtp*dt)-3'
  • Chain 'F':
    Compound: 5'-d(p*dap*dap*dcp*dcp*dgp*dgp*dc)-3'
  • Chain 'G':
    Compound: 5'-d(*dgp*dcp*dcp*dgp*dgp*dtp*dt)-3'
  • Chain 'H':
    Compound: 5'-d(p*dap*dap*dcp*dcp*dgp*dgp*dc)-3'
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3e44A (A:)
    sfikpiyqdinsiligqkvkrpksgtlsghaagepfeklvykflkenlsdltfkqyeyln
    dlfmknpaiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdq
    fyelldvktrnisksafapniisayklaqtcakmidnkefdlfdinylevdwelngedlv
    cvstsfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqr
    aismidkfvkpfkkyil
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e44A (A:)
    sfikpiyqdinsiligqkvkraagepfeklvykflkenlsdltfkqyeylndlfmknpai
    ighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdqfyelldvkt
    rnisksafapniisayklaqtcakmidnkefdlfdinylevdwelngedlvcvstsfael
    fksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqraismidkfv
    kpfkkyi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3e44B (B:)
    sfikpiyqdinsiligqkvkrpksgtlsghaagepfeklvykflkenlsdltfkqyeyln
    dlfmknpaiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdq
    fyelldvktrnisksafapniisayklaqtcakmidnkefdlfdinylevdwelngedlv
    cvstsfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqr
    aismidkfvkpfkkyil
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e44B (B:)
    sfikpiyqdinsiligqkvpfeklvykflkenlsdltfkqyeylndlfmknpaiighear
    yklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdqfyelldvktrnisks
    afapniisayklaqtcakmidnkefdlfdinylevdwelngedlvcvstsfaelfkseps
    elyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqraismidkfvkpfkky
    i
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.