PDB entry 3e3t

View 3e3t on RCSB PDB site
Description: Structure of porcine pancreatic elastase with the magic triangle I3C
Class: Hydrolase
Keywords: Phasing tool, 5-amino-2,4,6-triiodoisophthalic acid, magic triangle, I3C, Hydrolase, Metal-binding, Protease, Secreted, Serine protease, Zymogen
Deposited on 2008-08-08, released 2008-10-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-04-11, with a file datestamp of 2012-04-06.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.159
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Elastase-1
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00772 (0-239)
    • see remark 999 (65)
  Domains in SCOPe 2.08: d3e3ta_
• Heterogens: SO4, NA, IOD, I3C, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3e3tA (A:)
  vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
  nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
  lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
  rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn