PDB entry 3e3o

View 3e3o on RCSB PDB site
Description: Glycogen phosphorylase R state-IMP complex
Class: transferase
Keywords: GLYCOGENOLYSIS, INHIBITION, TYPE 2 DIABETES, Allosteric enzyme, Carbohydrate metabolism, Glycogen metabolism, Glycosyltransferase, Nucleotide-binding, Phosphoprotein, Pyridoxal phosphate, Transferase
Deposited on 2008-08-07, released 2009-08-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen phosphorylase, muscle form
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00489
      • conflict (379)
    Domains in SCOPe 2.07: d3e3oa_
  • Chain 'B':
    Compound: Glycogen phosphorylase, muscle form
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00489
      • conflict (379)
    Domains in SCOPe 2.07: d3e3ob_
  • Chain 'C':
    Compound: Glycogen phosphorylase, muscle form
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00489
      • conflict (379)
    Domains in SCOPe 2.07: d3e3oc_
  • Chain 'D':
    Compound: Glycogen phosphorylase, muscle form
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00489
      • conflict (379)
    Domains in SCOPe 2.07: d3e3od_
  • Heterogens: SO4, IMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3e3oA (A:)
    srplsdqekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvr
    dhlvgrwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldme
    eleeieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeead
    dwlrygnpwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvnt
    mrlwsakapndfnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvv
    aatlqdiirrfksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerld
    wdkawevtvktcaytnhtvipealerwpvhlletllprhlqiiyeinqrflnrvaaafpg
    dvdrlrrmslveegavkrinmahlciagshavngvarihseilkktifkdfyelephkfq
    nktngitprrwlvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqe
    nklkfaaylereykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvp
    rtvmiggkaapgyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaa
    dlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdr
    ldqrgynaqeyydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeey
    vkcqervsalyknprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapdek
    ip
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e3oA (A:)
    qekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgr
    wirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeie
    edaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlryg
    npwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsa
    kapndfvggyiqavldrnlaenisrvlypegkelrlkqeyfvvaatlqdiirrfkstnfd
    afpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtvktcaytnhtvipealerw
    pvhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslveegavkrinmahlcia
    gshavngvarihseilkktifkdfyelephkfqnktngitprrwlvlcnpglaeiiaeri
    geeyisdldqlrkllsyvddeafirdvakvkqenklkfaaylereykvhinpnslfdvqv
    kriheykrqllnclhvitlynrikkepnkfvvprtvmiggkaapgyhmakmiiklitaig
    dvvnhdpvvgdrlrviflenyrvslaekvipaadlseqistagteasgtgnmkfmlngal
    tigtmdganvemaeeageenffifgmrvedvdrldqrgynaqeyydripelrqiieqlss
    gffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalyknprewtrmvirniat
    sgkfssdrtiaqyareiwgvepsrqrlpap
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3e3oB (B:)
    srplsdqekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvr
    dhlvgrwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldme
    eleeieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeead
    dwlrygnpwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvnt
    mrlwsakapndfnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvv
    aatlqdiirrfksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerld
    wdkawevtvktcaytnhtvipealerwpvhlletllprhlqiiyeinqrflnrvaaafpg
    dvdrlrrmslveegavkrinmahlciagshavngvarihseilkktifkdfyelephkfq
    nktngitprrwlvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqe
    nklkfaaylereykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvp
    rtvmiggkaapgyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaa
    dlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdr
    ldqrgynaqeyydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeey
    vkcqervsalyknprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapdek
    ip
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e3oB (B:)
    qekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgr
    wirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeie
    edaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlryg
    npwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsa
    kapndfvggyiqavldrnlaenisrvlypegkelrlkqeyfvvaatlqdiirrfkssktn
    fdafpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtvktcaytnhtvipeale
    rwpvhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslveegavkrinmahlc
    iagshavngvarihseilkktifkdfyelephkfqnktngitprrwlvlcnpglaeiiae
    rigeeyisdldqlrkllsyvddeafirdvakvkqenklkfaaylereykvhinpnslfdv
    qvkriheykrqllnclhvitlynrikkepnkfvvprtvmiggkaapgyhmakmiiklita
    igdvvnhdpvvgdrlrviflenyrvslaekvipaadlseqistagteasgtgnmkfmlng
    altigtmdganvemaeeageenffifgmrvedvdrldqrgynaqeyydripelrqiieql
    ssgffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalyknprewtrmvirni
    atsgkfssdrtiaqyareiwgvepsrqrlpap
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3e3oC (C:)
    srplsdqekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvr
    dhlvgrwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldme
    eleeieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeead
    dwlrygnpwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvnt
    mrlwsakapndfnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvv
    aatlqdiirrfksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerld
    wdkawevtvktcaytnhtvipealerwpvhlletllprhlqiiyeinqrflnrvaaafpg
    dvdrlrrmslveegavkrinmahlciagshavngvarihseilkktifkdfyelephkfq
    nktngitprrwlvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqe
    nklkfaaylereykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvp
    rtvmiggkaapgyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaa
    dlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdr
    ldqrgynaqeyydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeey
    vkcqervsalyknprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapdek
    ip
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e3oC (C:)
    krkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrwi
    rtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeieed
    aglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygnp
    wekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsaka
    pndfnlggyiqavldrnlaenisrvlykelrlkqeyfvvaatlqdiirrfkssrtnfdaf
    pdkvaiqlndthpslaipelmrvlvdlerldwdkawevtvktcaytnhtvipealerwpv
    hlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslveegavkrinmahlciags
    havngvarihseilkktifkdfyelephkfqnktngitprrwlvlcnpglaeiiaerige
    eyisdldqlrkllsyvddeafirdvakvkqenklkfaaylereykvhinpnslfdvqvkr
    iheykrqllnclhvitlynrikkepnkfvvprtvmiggkaapgyhmakmiiklitaigdv
    vnhdpvvgdrlrviflenyrvslaekvipaadlseqistagteasgtgnmkfmlngalti
    gtmdganvemaeeageenffifgmrvedvdrldqrgynaqeyydripelrqiieqlssgf
    fspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalyknprewtrmvirniatsg
    kfssdrtiaqyareiwgvepsrqrlpap
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3e3oD (D:)
    srplsdqekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvr
    dhlvgrwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldme
    eleeieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeead
    dwlrygnpwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvnt
    mrlwsakapndfnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvv
    aatlqdiirrfksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerld
    wdkawevtvktcaytnhtvipealerwpvhlletllprhlqiiyeinqrflnrvaaafpg
    dvdrlrrmslveegavkrinmahlciagshavngvarihseilkktifkdfyelephkfq
    nktngitprrwlvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqe
    nklkfaaylereykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvp
    rtvmiggkaapgyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaa
    dlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdr
    ldqrgynaqeyydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeey
    vkcqervsalyknprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapdek
    ip
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e3oD (D:)
    ekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrw
    irtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeiee
    daglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygn
    pwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsak
    apndfyiqavldrnlaenisrvlyegkelrlkqeyfvvaatlqdiirrfksstnfdafpd
    kvaiqlndthpslaipelmrvlvdlerldwdkawevtvktcaytnhtvipealerwpvhl
    letllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslveegavkrinmahlciagsha
    vngvarihseilkktifkdfyelephkfqnktngitprrwlvlcnpglaeiiaerigeey
    isdldqlrkllsyvddeafirdvakvkqenklkfaaylereykvhinpnslfdvqvkrih
    eykrqllnclhvitlynrikkepnkfvvprtvmiggkaapgyhmakmiiklitaigdvvn
    hdpvvgdrlrviflenyrvslaekvipaadlseqistagteasgtgnmkfmlngaltigt
    mdganvemaeeageenffifgmrvedvdrldqrgynaqeyydripelrqiieqlssgffs
    pkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalyknprewtrmvirniatsgkf
    ssdrtiaqyareiwgvepsrqrlpap