PDB entry 3e3n

View 3e3n on RCSB PDB site
Description: The Glycogen phosphorylase b R state- AMP complex
Class: transferase
Keywords: GLYCOGENOLYSIS, INHIBITION, TYPE 2 DIABETES, Allosteric enzyme, Carbohydrate metabolism, Glycogen metabolism, Glycosyltransferase, Nucleotide-binding, Phosphoprotein, Pyridoxal phosphate, Transferase
Deposited on 2008-08-07, released 2009-08-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen phosphorylase, muscle form
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e3na_
  • Chain 'B':
    Compound: Glycogen phosphorylase, muscle form
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e3nb_
  • Chain 'C':
    Compound: Glycogen phosphorylase, muscle form
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e3nc_
  • Chain 'D':
    Compound: Glycogen phosphorylase, muscle form
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e3nd_
  • Chain 'E':
    Compound: Glycogen phosphorylase, muscle form
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e3ne_
  • Chain 'F':
    Compound: Glycogen phosphorylase, muscle form
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e3nf_
  • Chain 'G':
    Compound: Glycogen phosphorylase, muscle form
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e3ng_
  • Chain 'H':
    Compound: Glycogen phosphorylase, muscle form
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e3nh_
  • Heterogens: AMP, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3e3nA (A:)
    srplsdqekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvr
    dhlvgrwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldme
    eleeieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeead
    dwlrygnpwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvnt
    mrlwsakapndfnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvv
    aatlqdiirrfksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerld
    wdkawevtvktcaytnhtvlpealerwpvhlletllprhlqiiyeinqrflnrvaaafpg
    dvdrlrrmslveegavkrinmahlciagshavngvarihseilkktifkdfyelephkfq
    nktngitprrwlvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqe
    nklkfaaylereykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvp
    rtvmiggkaapgyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaa
    dlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdr
    ldqrgynaqeyydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeey
    vkcqervsalyknprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapdek
    ip
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e3nA (A:)
    qekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgr
    wirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeie
    edaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlryg
    npwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsa
    kapngyiqavldrnlaenisrvlygkelrlkqeyfvvaatlqdiirrfksskfgcrdpvr
    tnfdafpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtvktcaytnhtvlpea
    lerwpvhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslveegavkrinmah
    lciagshavngvarihseilkktifkdfyelephkfqnktngitprrwlvlcnpglaeii
    aerigeeyisdldqlrkllsyvddeafirdvakvkqenklkfaaylereykvhinpnslf
    dvqvkriheykrqllnclhvitlynrikkepnkfvvprtvmiggkaapgyhmakmiikli
    taigdvvnhdpvvgdrlrviflenyrvslaekvipaadlseqistagteasgtgnmkfml
    ngaltigtmdganvemaeeageenffifgmrvedvdrldqrgynaqeyydripelrqiie
    qlssgffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalyknprewtrmvir
    niatsgkfssdrtiaqyareiwgvepsrqrlpap
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3e3nB (B:)
    srplsdqekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvr
    dhlvgrwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldme
    eleeieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeead
    dwlrygnpwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvnt
    mrlwsakapndfnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvv
    aatlqdiirrfksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerld
    wdkawevtvktcaytnhtvlpealerwpvhlletllprhlqiiyeinqrflnrvaaafpg
    dvdrlrrmslveegavkrinmahlciagshavngvarihseilkktifkdfyelephkfq
    nktngitprrwlvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqe
    nklkfaaylereykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvp
    rtvmiggkaapgyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaa
    dlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdr
    ldqrgynaqeyydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeey
    vkcqervsalyknprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapdek
    ip
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e3nB (B:)
    qekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgr
    wirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeie
    edaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlryg
    npwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsa
    kapngyiqavldrnlaenisrvlypgkelrlkqeyfvvaatlqdiirrfksskfgcrdpv
    rtnfdafpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtvktcaytnhtvlpe
    alerwpvhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslveegavkrinma
    hlciagshavngvarihseilkktifkdfyelephkfqnktngitprrwlvlcnpglaei
    iaerigeeyisdldqlrkllsyvddeafirdvakvkqenklkfaaylereykvhinpnsl
    fdvqvkriheykrqllnclhvitlynrikkepnkfvvprtvmiggkaapgyhmakmiikl
    itaigdvvnhdpvvgdrlrviflenyrvslaekvipaadlseqistagteasgtgnmkfm
    lngaltigtmdganvemaeeageenffifgmrvedvdrldqrgynaqeyydripelrqii
    eqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalyknprewtrmvi
    rniatsgkfssdrtiaqyareiwgvepsrqrlpap
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3e3nC (C:)
    srplsdqekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvr
    dhlvgrwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldme
    eleeieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeead
    dwlrygnpwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvnt
    mrlwsakapndfnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvv
    aatlqdiirrfksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerld
    wdkawevtvktcaytnhtvlpealerwpvhlletllprhlqiiyeinqrflnrvaaafpg
    dvdrlrrmslveegavkrinmahlciagshavngvarihseilkktifkdfyelephkfq
    nktngitprrwlvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqe
    nklkfaaylereykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvp
    rtvmiggkaapgyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaa
    dlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdr
    ldqrgynaqeyydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeey
    vkcqervsalyknprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapdek
    ip
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e3nC (C:)
    krkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrwi
    rtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeieed
    aglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygnp
    wekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsaka
    pngyiqavldrnlaenisrvlygkelrlkqeyfvvaatlqdiirrfkssnfdafpdkvai
    qlndthpslaipelmrvlvdlerldwdkawevtvktcaytnhtvlpealerwpvhlletl
    lprhlqiiyeinqrflnrvaaafpgdvdrlrrmslveegavkrinmahlciagshavngv
    arihseilkktifkdfyelephkfqnktngitprrwlvlcnpglaeiiaerigeeyisdl
    dqlrkllsyvddeafirdvakvkqenklkfaaylereykvhinpnslfdvqvkriheykr
    qllnclhvitlynrikkepnkfvvprtvmiggkaapgyhmakmiiklitaigdvvnhdpv
    vgdrlrviflenyrvslaekvipaadlseqistagteasgtgnmkfmlngaltigtmdga
    nvemaeeageenffifgmrvedvdrldqrgynaqeyydripelrqiieqlssgffspkqp
    dlfkdivnmlmhhdrfkvfadyeeyvkcqervsalyknprewtrmvirniatsgkfssdr
    tiaqyareiwgvepsrqrlpap
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3e3nD (D:)
    srplsdqekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvr
    dhlvgrwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldme
    eleeieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeead
    dwlrygnpwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvnt
    mrlwsakapndfnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvv
    aatlqdiirrfksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerld
    wdkawevtvktcaytnhtvlpealerwpvhlletllprhlqiiyeinqrflnrvaaafpg
    dvdrlrrmslveegavkrinmahlciagshavngvarihseilkktifkdfyelephkfq
    nktngitprrwlvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqe
    nklkfaaylereykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvp
    rtvmiggkaapgyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaa
    dlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdr
    ldqrgynaqeyydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeey
    vkcqervsalyknprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapdek
    ip
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e3nD (D:)
    qekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgr
    wirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeie
    edaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlryg
    npwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsa
    kapngyiqavldrnlaenisrvlygkelrlkqeyfvvaatlqdiirrfksskfgcrdpvr
    tnfdafpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtvktcaytnhtvlpea
    lerwpvhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslveegavkrinmah
    lciagshavngvarihseilkktifkdfyelephkfqnktngitprrwlvlcnpglaeii
    aerigeeyisdldqlrkllsyvddeafirdvakvkqenklkfaaylereykvhinpnslf
    dvqvkriheykrqllnclhvitlynrikkepnkfvvprtvmiggkaapgyhmakmiikli
    taigdvvnhdpvvgdrlrviflenyrvslaekvipaadlseqistagteasgtgnmkfml
    ngaltigtmdganvemaeeageenffifgmrvedvdrldqrgynaqeyydripelrqiie
    qlssgffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalyknprewtrmvir
    niatsgkfssdrtiaqyareiwgvepsrqrlpapd
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3e3nE (E:)
    srplsdqekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvr
    dhlvgrwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldme
    eleeieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeead
    dwlrygnpwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvnt
    mrlwsakapndfnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvv
    aatlqdiirrfksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerld
    wdkawevtvktcaytnhtvlpealerwpvhlletllprhlqiiyeinqrflnrvaaafpg
    dvdrlrrmslveegavkrinmahlciagshavngvarihseilkktifkdfyelephkfq
    nktngitprrwlvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqe
    nklkfaaylereykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvp
    rtvmiggkaapgyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaa
    dlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdr
    ldqrgynaqeyydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeey
    vkcqervsalyknprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapdek
    ip
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e3nE (E:)
    ekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrw
    irtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeiee
    daglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygn
    pwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsak
    apngyiqavldrnlaenisrvlygkelrlkqeyfvvaatlqdiirrfkssnfdafpdkva
    iqlndthpslaipelmrvlvdlerldwdkawevtvktcaytnhtvlpealerwpvhllet
    llprhlqiiyeinqrflnrvaaafpgdvdrlrrmslveegavkrinmahlciagshavng
    varihseilkktifkdfyelephkfqnktngitprrwlvlcnpglaeiiaerigeeyisd
    ldqlrkllsyvddeafirdvakvkqenklkfaaylereykvhinpnslfdvqvkriheyk
    rqllnclhvitlynrikkepnkfvvprtvmiggkaapgyhmakmiiklitaigdvvnhdp
    vvgdrlrviflenyrvslaekvipaadlseqistagteasgtgnmkfmlngaltigtmdg
    anvemaeeageenffifgmrvedvdrldqrgynaqeyydripelrqiieqlssgffspkq
    pdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalyknprewtrmvirniatsgkfssd
    rtiaqyareiwgvepsrqrlpap
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3e3nF (F:)
    srplsdqekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvr
    dhlvgrwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldme
    eleeieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeead
    dwlrygnpwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvnt
    mrlwsakapndfnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvv
    aatlqdiirrfksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerld
    wdkawevtvktcaytnhtvlpealerwpvhlletllprhlqiiyeinqrflnrvaaafpg
    dvdrlrrmslveegavkrinmahlciagshavngvarihseilkktifkdfyelephkfq
    nktngitprrwlvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqe
    nklkfaaylereykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvp
    rtvmiggkaapgyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaa
    dlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdr
    ldqrgynaqeyydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeey
    vkcqervsalyknprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapdek
    ip
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e3nF (F:)
    ekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrw
    irtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeiee
    daglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygn
    pwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsak
    apngyiqavldrnlaenisrvlygkelrlkqeyfvvaatlqdiirrfksskfgcrdpvrt
    nfdafpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtvktcaytnhtvlpeal
    erwpvhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslveegavkrinmahl
    ciagshavngvarihseilkktifkdfyelephkfqnktngitprrwlvlcnpglaeiia
    erigeeyisdldqlrkllsyvddeafirdvakvkqenklkfaaylereykvhinpnslfd
    vqvkriheykrqllnclhvitlynrikkepnkfvvprtvmiggkaapgyhmakmiiklit
    aigdvvnhdpvvgdrlrviflenyrvslaekvipaadlseqistagteasgtgnmkfmln
    galtigtmdganvemaeeageenffifgmrvedvdrldqrgynaqeyydripelrqiieq
    lssgffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalyknprewtrmvirn
    iatsgkfssdrtiaqyareiwgvepsrqrlpap
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3e3nG (G:)
    srplsdqekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvr
    dhlvgrwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldme
    eleeieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeead
    dwlrygnpwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvnt
    mrlwsakapndfnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvv
    aatlqdiirrfksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerld
    wdkawevtvktcaytnhtvlpealerwpvhlletllprhlqiiyeinqrflnrvaaafpg
    dvdrlrrmslveegavkrinmahlciagshavngvarihseilkktifkdfyelephkfq
    nktngitprrwlvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqe
    nklkfaaylereykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvp
    rtvmiggkaapgyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaa
    dlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdr
    ldqrgynaqeyydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeey
    vkcqervsalyknprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapdek
    ip
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e3nG (G:)
    qekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgr
    wirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeie
    edaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlryg
    npwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsa
    kapngyiqavldrnlaenisrvlygkelrlkqeyfvvaatlqdiirrfksskfgcrdpvr
    tnfdafpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtvktcaytnhtvlpea
    lerwpvhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslveegavkrinmah
    lciagshavngvarihseilkktifkdfyelephkfqnktngitprrwlvlcnpglaeii
    aerigeeyisdldqlrkllsyvddeafirdvakvkqenklkfaaylereykvhinpnslf
    dvqvkriheykrqllnclhvitlynrikkepnkfvvprtvmiggkaapgyhmakmiikli
    taigdvvnhdpvvgdrlrviflenyrvslaekvipaadlseqistagteasgtgnmkfml
    ngaltigtmdganvemaeeageenffifgmrvedvdrldqrgynaqeyydripelrqiie
    qlssgffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalyknprewtrmvir
    niatsgkfssdrtiaqyareiwgvepsrqrlpap
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3e3nH (H:)
    srplsdqekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvr
    dhlvgrwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldme
    eleeieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeead
    dwlrygnpwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvnt
    mrlwsakapndfnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvv
    aatlqdiirrfksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerld
    wdkawevtvktcaytnhtvlpealerwpvhlletllprhlqiiyeinqrflnrvaaafpg
    dvdrlrrmslveegavkrinmahlciagshavngvarihseilkktifkdfyelephkfq
    nktngitprrwlvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqe
    nklkfaaylereykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvp
    rtvmiggkaapgyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaa
    dlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdr
    ldqrgynaqeyydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeey
    vkcqervsalyknprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapdek
    ip
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e3nH (H:)
    dqekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvg
    rwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleei
    eedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlry
    gnpwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlws
    akapngyiqavldrnlaenisrvlygkelrlkqeyfvvaatlqdiirrfksskfgcrdpv
    rtnfdafpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtvktcaytnhtvlpe
    alerwpvhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslveegavkrinma
    hlciagshavngvarihseilkktifkdfyelephkfqnktngitprrwlvlcnpglaei
    iaerigeeyisdldqlrkllsyvddeafirdvakvkqenklkfaaylereykvhinpnsl
    fdvqvkriheykrqllnclhvitlynrikkepnkfvvprtvmiggkaapgyhmakmiikl
    itaigdvvnhdpvvgdrlrviflenyrvslaekvipaadlseqistagteasgtgnmkfm
    lngaltigtmdganvemaeeageenffifgmrvedvdrldqrgynaqeyydripelrqii
    eqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalyknprewtrmvi
    rniatsgkfssdrtiaqyareiwgvepsrqrlpa