PDB entry 3e3l

View 3e3l on RCSB PDB site
Description: The R-state Glycogen Phosphorylase
Class: transferase
Keywords: GLYCOGENOLYSIS, INHIBITION, TYPE 2 DIABETES, Allosteric enzyme, Carbohydrate metabolism, Glycogen metabolism, Glycosyltransferase, Nucleotide-binding, Phosphoprotein, Pyridoxal phosphate, Transferase
Deposited on 2008-08-07, released 2009-02-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen phosphorylase, muscle form
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e3la_
  • Chain 'B':
    Compound: Glycogen phosphorylase, muscle form
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e3lb_
  • Chain 'C':
    Compound: Glycogen phosphorylase, muscle form
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e3lc_
  • Chain 'D':
    Compound: Glycogen phosphorylase, muscle form
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e3ld_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3e3lA (A:)
    srplsdqekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvr
    dhlvgrwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldme
    eleeieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeead
    dwlrygnpwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvnt
    mrlwsakapndfnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvv
    aatlqdiirrfksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerld
    wdkawevtvktcaytnhtvlpealerwpvhlletllprhlqiiyeinqrflnrvaaafpg
    dvdrlrrmslveegavkrinmahlciagshavngvarihseilkktifkdfyelephkfq
    nktngitprrwlvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqe
    nklkfaaylereykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvp
    rtvmiggkaapgyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaa
    dlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdr
    ldqrgynaqeyydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeey
    vkcqervsalyknprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapdek
    ip
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e3lA (A:)
    qekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgr
    wirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeie
    edaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlryg
    npwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsa
    kapndfvggyiqavldrnlaenisrvlypegkelrlkqeyfvvaatlqdiirrfkstnfd
    afpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtvktcaytnhtvlpealerw
    pvhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslveegavkrinmahlcia
    gshavngvarihseilkktifkdfyelephkfqnktngitprrwlvlcnpglaeiiaeri
    geeyisdldqlrkllsyvddeafirdvakvkqenklkfaaylereykvhinpnslfdvqv
    kriheykrqllnclhvitlynrikkepnkfvvprtvmiggkaapgyhmakmiiklitaig
    dvvnhdpvvgdrlrviflenyrvslaekvipaadlseqistagteasgtgnmkfmlngal
    tigtmdganvemaeeageenffifgmrvedvdrldqrgynaqeyydripelrqiieqlss
    gffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalyknprewtrmvirniat
    sgkfssdrtiaqyareiwgvepsrqrlpap
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3e3lB (B:)
    srplsdqekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvr
    dhlvgrwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldme
    eleeieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeead
    dwlrygnpwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvnt
    mrlwsakapndfnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvv
    aatlqdiirrfksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerld
    wdkawevtvktcaytnhtvlpealerwpvhlletllprhlqiiyeinqrflnrvaaafpg
    dvdrlrrmslveegavkrinmahlciagshavngvarihseilkktifkdfyelephkfq
    nktngitprrwlvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqe
    nklkfaaylereykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvp
    rtvmiggkaapgyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaa
    dlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdr
    ldqrgynaqeyydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeey
    vkcqervsalyknprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapdek
    ip
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e3lB (B:)
    qekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgr
    wirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeie
    edaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlryg
    npwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsa
    kapndfggyiqavldrnlaenisrvlypgkelrlkqeyfvvaatlqdiirrfksstnfda
    fpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtvktcaytnhtvlpealerwp
    vhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslveegavkrinmahlciag
    shavngvarihseilkktifkdfyelephkfqnktngitprrwlvlcnpglaeiiaerig
    eeyisdldqlrkllsyvddeafirdvakvkqenklkfaaylereykvhinpnslfdvqvk
    riheykrqllnclhvitlynrikkepnkfvvprtvmiggkaapgyhmakmiiklitaigd
    vvnhdpvvgdrlrviflenyrvslaekvipaadlseqistagteasgtgnmkfmlngalt
    igtmdganvemaeeageenffifgmrvedvdrldqrgynaqeyydripelrqiieqlssg
    ffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalyknprewtrmvirniats
    gkfssdrtiaqyareiwgvepsrqrlpapde
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3e3lC (C:)
    srplsdqekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvr
    dhlvgrwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldme
    eleeieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeead
    dwlrygnpwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvnt
    mrlwsakapndfnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvv
    aatlqdiirrfksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerld
    wdkawevtvktcaytnhtvlpealerwpvhlletllprhlqiiyeinqrflnrvaaafpg
    dvdrlrrmslveegavkrinmahlciagshavngvarihseilkktifkdfyelephkfq
    nktngitprrwlvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqe
    nklkfaaylereykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvp
    rtvmiggkaapgyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaa
    dlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdr
    ldqrgynaqeyydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeey
    vkcqervsalyknprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapdek
    ip
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e3lC (C:)
    krkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrwi
    rtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeieed
    aglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygnp
    wekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsaka
    pndfnlggyiqavldrnlaenisrvlykelrlkqeyfvvaatlqdiirrfksstnfdafp
    dkvaiqlndthpslaipelmrvlvdlerldwdkawevtvktcaytnhtvlpealerwpvh
    lletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslveegavkrinmahlciagsh
    avngvarihseilkktifkdfyelephkfqnktngitprrwlvlcnpglaeiiaerigee
    yisdldqlrkllsyvddeafirdvakvkqenklkfaaylereykvhinpnslfdvqvkri
    heykrqllnclhvitlynrikkepnkfvvprtvmiggkaapgyhmakmiiklitaigdvv
    nhdpvvgdrlrviflenyrvslaekvipaadlseqistagteasgtgnmkfmlngaltig
    tmdganvemaeeageenffifgmrvedvdrldqrgynaqeyydripelrqiieqlssgff
    spkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalyknprewtrmvirniatsgk
    fssdrtiaqyareiwgvepsrqrlpap
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3e3lD (D:)
    srplsdqekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvr
    dhlvgrwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldme
    eleeieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeead
    dwlrygnpwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvnt
    mrlwsakapndfnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvv
    aatlqdiirrfksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerld
    wdkawevtvktcaytnhtvlpealerwpvhlletllprhlqiiyeinqrflnrvaaafpg
    dvdrlrrmslveegavkrinmahlciagshavngvarihseilkktifkdfyelephkfq
    nktngitprrwlvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqe
    nklkfaaylereykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvp
    rtvmiggkaapgyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaa
    dlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdr
    ldqrgynaqeyydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeey
    vkcqervsalyknprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapdek
    ip
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e3lD (D:)
    ekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrw
    irtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeiee
    daglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygn
    pwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsak
    apndfyiqavldrnlaenisrvlyegkelrlkqeyfvvaatlqdiirrfksstnfdafpd
    kvaiqlndthpslaipelmrvlvdlerldwdkawevtvktcaytnhtvlpealerwpvhl
    letllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslveegavkrinmahlciagsha
    vngvarihseilkktifkdfyelephkfqnktngitprrwlvlcnpglaeiiaerigeey
    isdldqlrkllsyvddeafirdvakvkqenklkfaaylereykvhinpnslfdvqvkrih
    eykrqllnclhvitlynrikkepnkfvvprtvmiggkaapgyhmakmiiklitaigdvvn
    hdpvvgdrlrviflenyrvslaekvipaadlseqistagteasgtgnmkfmlngaltigt
    mdganvemaeeageenffifgmrvedvdrldqrgynaqeyydripelrqiieqlssgffs
    pkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalyknprewtrmvirniatsgkf
    ssdrtiaqyareiwgvepsrqrlpap