PDB entry 3e3c

View 3e3c on RCSB PDB site
Description: Structure of GrlR-lipid complex
Deposited on 2008-08-07, released 2009-04-07
The last revision was dated 2009-04-07, with a file datestamp of 2009-04-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.231
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l0044
    Species: Escherichia coli [TaxId:562]
    Gene: ECs4578
    Database cross-references and differences (RAF-indexed):
    • Uniprot O85638 (7-117)
      • expression tag (0-6)
  • Chain 'B':
    Compound: l0044
    Species: Escherichia coli [TaxId:562]
    Gene: ECs4578
    Database cross-references and differences (RAF-indexed):
    • Uniprot O85638 (7-117)
      • expression tag (0-6)
  • Heterogens: HHG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3e3cA (A:)
glvprgsmimkdgiysiifisnedscgegilikngnmitggdiasvyqgvlsedediilh
vhrynyeipsvlnieqdyqlvipkkvlsndnnltlhchvrgneklfvdvyakfieplv

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3e3cB (B:)
glvprgsmimkdgiysiifisnedscgegilikngnmitggdiasvyqgvlsedediilh
vhrynyeipsvlnieqdyqlvipkkvlsndnnltlhchvrgneklfvdvyakfieplv