PDB entry 3e2o

View 3e2o on RCSB PDB site
Description: Crystal structure of cytochrome c peroxidase, N184R mutant
Class: oxidoreductase
Keywords: Cytochrome c peroxidase (ccp), Heme, Hydrogen peroxide, Iron, Metal-binding, Mitochondrion, Organic radical, Oxidoreductase, Transit peptide
Deposited on 2008-08-05, released 2008-10-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.06 Å
R-factor: 0.171
AEROSPACI score: 0.92 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c peroxidase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CCP1, CCP, CPO, YKR066C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00431 (Start-293)
      • engineered (183)
      • variant (234)
    Domains in SCOPe 2.06: d3e2oa_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3e2oA (A:)
    ttplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkh
    dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
    gpkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkt
    hlkrsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptbysliq
    dpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e2oA (A:)
    lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkhdnt
    ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
    ipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkthlk
    rsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptbysliqdpk
    ylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl