PDB entry 3e2n

View 3e2n on RCSB PDB site
Description: Engineering ascorbate peroxidase activity into cytochrome c peroxidase
Class: oxidoreductase
Keywords: Cytochrome c peroxidase (CCP), Ascorbate peroxidase (APX), OXIDOREDUCTASE
Deposited on 2008-08-05, released 2008-10-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.181
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c peroxidase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CCP1, CCP, CPO, YKR066C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00431 (Start-28)
      • engineered (176)
      • engineered (183)
    • Uniprot P48534 (29-34)
    • Uniprot P00431 (35-286)
    Domains in SCOPe 2.05: d3e2na_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3e2nA (A:)
    ttplvhvasvekgrsyedfqkvynaialkiaekkcgpvlvrlawhtsgtwdkhdntggsy
    ggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpkipwr
    cgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkthlkrsgy
    egpfgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpkylsi
    vkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e2nA (A:)
    hvasvekgrsyedfqkvynaialkiaekkcgpvlvrlawhtsgtwdkhdntggsyggtyr
    fkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpkipwrcgrvd
    tpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkthlkrsgyegpfg
    aannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpkylsivkeya
    ndqdkffkdfskafekllengitfpkdapspfifktleeqgl