PDB entry 3e2i

View 3e2i on RCSB PDB site
Description: Crystal structure of Thymidine Kinase from S. aureus
Class: transferase
Keywords: ZN-BINDING, ATP-binding, DNA synthesis, Kinase, Nucleotide-binding, Transferase
Deposited on 2008-08-05, released 2009-08-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thymidine kinase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: tdk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e2ia1, d3e2ia2
  • Heterogens: ZN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3e2iA (A:)
    mgsshhhhhhssglvprgshmyetyhsgwiecitgsmfsgkseelirrlrrgiyakqkvv
    vfkpaiddryhkekvvshngnaieainiskaseimthdltnvdvigidevqffddeivsi
    veklsadghrvivagldmdfrgepfepmpklmavseqvtklqavcavcgssssrtqrlin
    gkpakiddpiilvganesyeprcrahhivapsdnnkeel
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e2iA (A:)
    sgwiecitgsmfsgkseelirrlrrgiyakqkvvvfkpashngnaieainiskaseimth
    dltnvdvigidevqffddeivsiveklsadghrvivagldmdfrgepfepmpklmavseq
    vtklqavcavcgssssrtqrlingkpakiddpiilvganesyeprcrahhivaps