PDB entry 3e2h

View 3e2h on RCSB PDB site
Description: structure of the m67 high-affinity mutant of the 2c tcr in complex with ld/ql9
Deposited on 2008-08-05, released 2008-11-04
The last revision was dated 2021-10-20, with a file datestamp of 2021-10-15.
Experiment type: XRAY
Resolution: 3.8 Å
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: H-2 class I histocompatibility antigen, L-D alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: H2-L
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01897 (0-174)
      • engineered mutation (7)
      • engineered mutation (11)
      • engineered mutation (14)
      • engineered mutation (22)
      • engineered mutation (29)
      • engineered mutation (48)
      • engineered mutation (65)
      • engineered mutation (96)
      • engineered mutation (130)
  • Chain 'B':
    Compound: T-cell receptor alpha chain V region PHDS58
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01738 (0-108)
      • engineered mutation (41)
      • engineered mutation (80)
      • engineered mutation (92-96)
  • Chain 'C':
    Compound: M67 TCR beta chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3E2H (0-109)
  • Chain 'Q':
    Compound: QL9 peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3E2H (0-8)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3e2hA (A:)
gphsmryyetatsrrglgeprytsvgyvddkefvrfdsdaenpryepqvpwmeqegpeyw
eritqvakgqeqwfrvnlrtllgyynqsaggthtlqrmygcdvgsdgrllrgyeqfaydg
cdyialnedlrtwtaadmaaqitrrkweqagaaeyyraylegecvewlhrylkng

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3e2hB (B:)
svtqpdarvtvsegaslqlrckysysatpylfwyvqyprqgpqlllkyysgdpvvqgvng
feaefsksnssfhlrkasvhrsdsavyfcavslerpyltfgsgtkvivl

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >3e2hC (C:)
aavtqsprnkvavtgekvtlscnqtnnhnnmywyrqdtghelrliyysygagstekgdip
dgykasrpsqenfsltlesatpsqtsvyfcasggggtlyfgagtrlsvls

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records:
    >3e2hQ (Q:)
qlspfpfdl