PDB entry 3e2f

View 3e2f on RCSB PDB site
Description: Crystal structure of mouse kynurenine aminotransferase III, PLP-bound form
Class: transferase, lyase
Keywords: alpha beta protein, PLP dependent protein, Aminotransferase, Lyase, Pyridoxal phosphate, Transferase
Deposited on 2008-08-05, released 2008-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: 0.196
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kynurenine-oxoglutarate transaminase 3
    Species: Mus musculus [TaxId:10090]
    Gene: Ccbl2, Kat3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e2fa_
  • Chain 'B':
    Compound: Kynurenine-oxoglutarate transaminase 3
    Species: Mus musculus [TaxId:10090]
    Gene: Ccbl2, Kat3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e2fb_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e2fA (A:)
    nakriegldsnvwveftklaadpsvvnlgqgfpdisppsyvkeelskaafidnmnqytrg
    fghpalvkalsclygkiyqrqidpneeilvavgaygslfnsiqglvdpgdeviimvpfyd
    cyepmvrmagavpvfiplrskptdgmkwtssdwtfdpreleskfssktkaiilntphnpl
    gkvytrqelqviadlcvkhdtlcisdevyewlvytghthvkiatlpgmwertitigsagk
    tfsvtgwklgwsigpahlikhlqtvqqnsfytcatplqaalaeafwidikrmddpecyfn
    slpkelevkrdrmvrllnsvglkpivpdggyfiiadvsslgadlsdmnsdepydykfvkw
    mtkhkkltaipvsafcdskskphfeklvrfcfikkdstldaaeeifrawn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e2fB (B:)
    nakriegldsnvwveftklaadpsvvnlgqgfpdisppsyvkeelskaafidnmnqytrg
    fghpalvkalsclygkiyqrqidpneeilvavgaygslfnsiqglvdpgdeviimvpfyd
    cyepmvrmagavpvfiplrskptdgmkwtssdwtfdpreleskfssktkaiilntphnpl
    gkvytrqelqviadlcvkhdtlcisdevyewlvytghthvkiatlpgmwertitigsagk
    tfsvtgwklgwsigpahlikhlqtvqqnsfytcatplqaalaeafwidikrmddpecyfn
    slpkelevkrdrmvrllnsvglkpivpdggyfiiadvsslgadlsdmnsdepydykfvkw
    mtkhkkltaipvsafcdskskphfeklvrfcfikkdstldaaeeifrawn