PDB entry 3e2c

View 3e2c on RCSB PDB site
Description: Escherichia coli Bacterioferritin Mutant E128R/E135R
Class: oxidoreductase
Keywords: Diiron site, Iron storage, Metal-binding, Heme, Iron, OXIDOREDUCTASE
Deposited on 2008-08-05, released 2009-05-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacterioferritin
    Species: Escherichia coli [TaxId:83333]
    Gene: bfr, b3336, JW3298
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABD3 (0-157)
      • engineered (127)
      • engineered (134)
    Domains in SCOPe 2.07: d3e2ca_
  • Chain 'B':
    Compound: bacterioferritin
    Species: Escherichia coli [TaxId:83333]
    Gene: bfr, b3336, JW3298
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABD3 (0-157)
      • engineered (127)
      • engineered (134)
    Domains in SCOPe 2.07: d3e2cb_
  • Heterogens: ZN, SO4, HEM, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e2cA (A:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrderghidwlrteldliqkmglqnylqaqireeg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e2cB (B:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrderghidwlrteldliqkmglqnylqaqireeg