PDB entry 3e2b
View 3e2b on RCSB PDB site
Description: Crystal structure of Dynein Light chain LC8 in complex with a peptide derived from Swallow
Class: transport protein
Keywords: protein-peptide complex, transport protein, Cytoplasm, Dynein, Microtubule, Motor protein
Deposited on
2008-08-05, released
2008-08-12
The last revision prior to the SCOPe 2.07 freeze date was dated
2009-01-06, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.221
AEROSPACI score: 0.4
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Dynein light chain 1, cytoplasmic
Species: Drosophila melanogaster [TaxId:7227]
Gene: CTP, CDLC1, DDLC1, CG6998
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d3e2ba_ - Chain 'C':
Compound: Protein swallow 16-residue peptide
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Heterogens: ACT, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>3e2bA (A:)
msdrkaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgr
nfgsyvthetrhfiyfylgqvaillfksg
Sequence, based on observed residues (ATOM records): (download)
>3e2bA (A:)
drkaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgrnf
gsyvthetrhfiyfylgqvaillfksg
- Chain 'C':
No sequence available.