PDB entry 3e2b

View 3e2b on RCSB PDB site
Description: Crystal structure of Dynein Light chain LC8 in complex with a peptide derived from Swallow
Class: transport protein
Keywords: protein-peptide complex, transport protein, Cytoplasm, Dynein, Microtubule, Motor protein
Deposited on 2008-08-05, released 2008-08-12
The last revision prior to the SCOP 1.75 freeze date was dated 2009-01-06, with a file datestamp of 2009-01-02.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.221
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Dynein light chain 1, cytoplasmic
  Species: Drosophila melanogaster [TaxId:7227]
  Gene: CTP, CDLC1, DDLC1, CG6998
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q24117 (Start-88)
  Domains in SCOP 1.75: d3e2ba1
• Chain 'C':
  Compound: Protein swallow 16-residue peptide
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P40688 (Start-15)
• Heterogens: ACT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3e2bA (A:)
  msdrkaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgr
  nfgsyvthetrhfiyfylgqvaillfksg
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3e2bA (A:)
  drkaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgrnf
  gsyvthetrhfiyfylgqvaillfksg
  

  
  
• Chain 'C':
  No sequence available.