PDB entry 3e2b

View 3e2b on RCSB PDB site
Description: Crystal structure of Dynein Light chain LC8 in complex with a peptide derived from Swallow
Class: transport protein
Keywords: protein-peptide complex, transport protein, Cytoplasm, Dynein, Microtubule, Motor protein
Deposited on 2008-08-05, released 2008-08-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-01-06, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.221
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dynein light chain 1, cytoplasmic
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: CTP, CDLC1, DDLC1, CG6998
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3e2ba_
  • Chain 'C':
    Compound: Protein swallow 16-residue peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3e2bA (A:)
    msdrkaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgr
    nfgsyvthetrhfiyfylgqvaillfksg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e2bA (A:)
    drkaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgrnf
    gsyvthetrhfiyfylgqvaillfksg
    

  • Chain 'C':
    No sequence available.