PDB entry 3e2a

View 3e2a on RCSB PDB site
Description: H. influenzae beta-carbonic anhydrase, variant Y181F with 100 mM bicarbonate
Class: lyase
Keywords: beta carbonic anhydrase, allosteric site mutant, Lyase, Metal-binding
Deposited on 2008-08-05, released 2009-06-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.205
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbonic anhydrase 2
    Species: Haemophilus influenzae [TaxId:727]
    Gene: can, HI1301
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45148 (0-End)
      • engineered (180)
    Domains in SCOPe 2.06: d3e2aa_
  • Chain 'B':
    Compound: Carbonic anhydrase 2
    Species: Haemophilus influenzae [TaxId:727]
    Gene: can, HI1301
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45148 (0-End)
      • engineered (180)
    Domains in SCOPe 2.06: d3e2ab_
  • Chain 'C':
    Compound: Carbonic anhydrase 2
    Species: Haemophilus influenzae [TaxId:727]
    Gene: can, HI1301
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45148 (0-End)
      • engineered (180)
    Domains in SCOPe 2.06: d3e2ac_
  • Chain 'D':
    Compound: Carbonic anhydrase 2
    Species: Haemophilus influenzae [TaxId:727]
    Gene: can, HI1301
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45148 (0-End)
      • engineered (180)
    Domains in SCOPe 2.06: d3e2ad_
  • Chain 'E':
    Compound: Carbonic anhydrase 2
    Species: Haemophilus influenzae [TaxId:727]
    Gene: can, HI1301
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45148 (0-End)
      • engineered (180)
    Domains in SCOPe 2.06: d3e2ae_
  • Chain 'F':
    Compound: Carbonic anhydrase 2
    Species: Haemophilus influenzae [TaxId:727]
    Gene: can, HI1301
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45148 (0-End)
      • engineered (180)
    Domains in SCOPe 2.06: d3e2af_
  • Heterogens: ZN, SO4, BCT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3e2aA (A:)
    mdkikqlfannyswaqrmkeenstyfkeladhqtphylwigcsdsrvpaekltnlepgel
    fvhrnvanqvihtdfnclsvvqyavdvlkiehiiicghtncggihaamadkdlglinnwl
    lhirdiwfkhghllgklspekradmltkinvaeqvynlgrtsivksawergqklslhgwv
    fdvndgflvdqgvmatsretleisyrnaiarlsildeenilkkdhlent
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e2aA (A:)
    mdkikqlfannyswaqrmkhqtphylwigcsdsrvpaekltnlepgelfvhrnvanqvih
    tdfnclsvvqyavdvlkiehiiicghtncggihaamadkdlglinnwllhirdiwfkhgh
    llgklspekradmltkinvaeqvynlgrtsivksawergqklslhgwvfdvndgflvdqg
    vmatsretleisyrnaiarlsildeenil
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3e2aB (B:)
    mdkikqlfannyswaqrmkeenstyfkeladhqtphylwigcsdsrvpaekltnlepgel
    fvhrnvanqvihtdfnclsvvqyavdvlkiehiiicghtncggihaamadkdlglinnwl
    lhirdiwfkhghllgklspekradmltkinvaeqvynlgrtsivksawergqklslhgwv
    fdvndgflvdqgvmatsretleisyrnaiarlsildeenilkkdhlent
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e2aB (B:)
    mdkikqlfannyswaqrmqtphylwigcsdsrvpaekltnlepgelfvhrnvanqvihtd
    fnclsvvqyavdvlkiehiiicghtncggihaamadkdlglinnwllhirdiwfkhghll
    gklspekradmltkinvaeqvynlgrtsivksawergqklslhgwvfdvndgflvdqgvm
    atsretleisyrnaiarlsildeenil
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3e2aC (C:)
    mdkikqlfannyswaqrmkeenstyfkeladhqtphylwigcsdsrvpaekltnlepgel
    fvhrnvanqvihtdfnclsvvqyavdvlkiehiiicghtncggihaamadkdlglinnwl
    lhirdiwfkhghllgklspekradmltkinvaeqvynlgrtsivksawergqklslhgwv
    fdvndgflvdqgvmatsretleisyrnaiarlsildeenilkkdhlent
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e2aC (C:)
    mdkikqlfannyswaqrmktphylwigcsdsrvpaekltnlepgelfvhrnvanqvihtd
    fnclsvvqyavdvlkiehiiicghtncggihaamadkdlglinnwllhirdiwfkhghll
    gklspekradmltkinvaeqvynlgrtsivksawergqklslhgwvfdvndgflvdqgvm
    atsretleisyrnaiarlsildeen
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3e2aD (D:)
    mdkikqlfannyswaqrmkeenstyfkeladhqtphylwigcsdsrvpaekltnlepgel
    fvhrnvanqvihtdfnclsvvqyavdvlkiehiiicghtncggihaamadkdlglinnwl
    lhirdiwfkhghllgklspekradmltkinvaeqvynlgrtsivksawergqklslhgwv
    fdvndgflvdqgvmatsretleisyrnaiarlsildeenilkkdhlent
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e2aD (D:)
    mdkikqlfannyswaqrmadhqtphylwigcsdsrvpaekltnlepgelfvhrnvanqvi
    htdfnclsvvqyavdvlkiehiiicghtncggihaamadkdlglinnwllhirdiwfkhg
    hllgklspekradmltkinvaeqvynlgrtsivksawergqklslhgwvfdvndgflvdq
    gvmatsretleisyrnaiarlsil
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3e2aE (E:)
    mdkikqlfannyswaqrmkeenstyfkeladhqtphylwigcsdsrvpaekltnlepgel
    fvhrnvanqvihtdfnclsvvqyavdvlkiehiiicghtncggihaamadkdlglinnwl
    lhirdiwfkhghllgklspekradmltkinvaeqvynlgrtsivksawergqklslhgwv
    fdvndgflvdqgvmatsretleisyrnaiarlsildeenilkkdhlent
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e2aE (E:)
    mdkikqlfannyswaqrmhqtphylwigcsdsrvpaekltnlepgelfvhrnvanqviht
    dfnclsvvqyavdvlkiehiiicghtncggihaamadkdlglinnwllhirdiwfkhghl
    lgklspekradmltkinvaeqvynlgrtsivksawergqklslhgwvfdvndgflvdqgv
    matsretleisyrnaiarlsildeeni
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3e2aF (F:)
    mdkikqlfannyswaqrmkeenstyfkeladhqtphylwigcsdsrvpaekltnlepgel
    fvhrnvanqvihtdfnclsvvqyavdvlkiehiiicghtncggihaamadkdlglinnwl
    lhirdiwfkhghllgklspekradmltkinvaeqvynlgrtsivksawergqklslhgwv
    fdvndgflvdqgvmatsretleisyrnaiarlsildeenilkkdhlent
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e2aF (F:)
    mdkikqlfannyswaqrmtphylwigcsdsrvpaekltnlepgelfvhrnvanqvihtdf
    nclsvvqyavdvlkiehiiicghtncggihaamadkdlglinnwllhirdiwfkhghllg
    klspekradmltkinvaeqvynlgrtsivksawergqklslhgwvfdvndgflvdqgvma
    tsretleisyrnaiarlsildeen