PDB entry 3e22
View 3e22 on RCSB PDB site
Description: Tubulin-colchicine-soblidotin: Stathmin-like domain complex
Class: cell cycle
Keywords: alpha-tubulin, beta-tubulin, colchicine, gtpase, microtubule, soblidotin, stathmin, tubulin, CELL CYCLE
Deposited on
2008-08-05, released
2008-10-21
The last revision prior to the SCOPe 2.05 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 3.8 Å
R-factor: 0.231
AEROSPACI score: 0.05
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Tubulin alpha-1C chain
Species: Bos taurus [TaxId:9913]
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: Tubulin beta-2B chain
Species: Bos taurus [TaxId:9913]
Database cross-references and differences (RAF-indexed):
- Uniprot Q6B856
- see remark 999 (200)
- see remark 999 (315)
- Chain 'C':
Compound: Tubulin alpha-1C chain
Species: Bos taurus [TaxId:9913]
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: Tubulin beta-2B chain
Species: Bos taurus [TaxId:9913]
Database cross-references and differences (RAF-indexed):
- Uniprot Q6B856
- see remark 999 (200)
- see remark 999 (315)
- Chain 'E':
Compound: Stathmin-4
Species: Rattus norvegicus [TaxId:10116]
Gene: STMN4
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d3e22e1 - Heterogens: GTP, MG, GDP, LOC, TZT
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
No sequence available.
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.
- Chain 'E':
Sequence, based on SEQRES records: (download)
>3e22E (E:)
admevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrky
qeaellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerl
qekdkhaeevrknkelkeeasr
Sequence, based on observed residues (ATOM records): (download)
>3e22E (E:)
admevielnkctsgqsfevilkppsfdpsleeiqkkleaaeerrkyqeaellkhlaekre
hereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknk
elke