PDB entry 3e1z

View 3e1z on RCSB PDB site
Description: Crystal structure of the parasite protesase inhibitor chagasin in complex with papain
Class: hydrolase inhibitor/hydrolase
Keywords: chagasin-papain complex, papain, Chagas disease, cysteine proteinases, protein inhibitors, Cytoplasmic vesicle, Protease inhibitor, Thiol protease inhibitor, Allergen, Hydrolase, Protease, Thiol protease, Zymogen, HYDROLASE INHIBITOR/HYDROLASE COMPLEX
Deposited on 2008-08-05, released 2009-01-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-01-27, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.166
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chagasin
    Species: Trypanosoma cruzi [TaxId:5693]
    Gene: cha
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3e1za_
  • Chain 'B':
    Compound: papain
    Species: Carica papaya [TaxId:3649]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3e1zb_
  • Heterogens: ZN, FMT, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3e1zA (A:)
mshkvtkahngatltvavgelveiqlpsnpttgfawyfeggtkespnesmftvenkyfpp
dskllgaggtehfhvtvkaagthavnltymrpwtgpshdserftvylkan

    Sequence, based on observed residues (ATOM records): (download) 
    >3e1zA (A:)
shkvtkahngatltvavgelveiqlpsnpttgfawyfeggtkespnesmftvenkyfppd
skllgaggtehfhvtvkaagthavnltymrpwtgpshdserftvylkan

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3e1zB (B:)
ipeyvdwrqkgavtpvknqgscgscwafsavvtiegiikirtgnlneyseqelldcdrrs
ygcnggypwsalqlvaqygihyrntypyegvqrycrsrekgpyaaktdgvrqvqpynega
llysianqpvsvvleaagkdfqlyrggifvgpcgnkvdhavaavgygpnyiliknswgtg
wgengyirikrgtgnsygvcglytssfypvkn