PDB entry 3e1j

View 3e1j on RCSB PDB site
Description: Crystal structure of E. coli Bacterioferritin (BFR) with an unoccupied ferroxidase centre (APO-BFR).
Class: metal binding protein
Keywords: rhombic dodecahedral superstructure. apo-bfr., heme, iron, iron storage, metal-binding, metal binding protein
Deposited on 2008-08-04, released 2009-05-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-05-26, with a file datestamp of 2009-05-22.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.243
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacterioferritin
    Species: Escherichia coli K12 [TaxId:83333]
    Gene: bfr, b3336, JW3298
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e1ja_
  • Chain 'B':
    Compound: bacterioferritin
    Species: Escherichia coli K12 [TaxId:83333]
    Gene: bfr, b3336, JW3298
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e1jb_
  • Chain 'C':
    Compound: bacterioferritin
    Species: Escherichia coli K12 [TaxId:83333]
    Gene: bfr, b3336, JW3298
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e1jc_
  • Chain 'D':
    Compound: bacterioferritin
    Species: Escherichia coli K12 [TaxId:83333]
    Gene: bfr, b3336, JW3298
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e1jd_
  • Chain 'E':
    Compound: bacterioferritin
    Species: Escherichia coli K12 [TaxId:83333]
    Gene: bfr, b3336, JW3298
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e1je_
  • Chain 'F':
    Compound: bacterioferritin
    Species: Escherichia coli K12 [TaxId:83333]
    Gene: bfr, b3336, JW3298
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e1jf_
  • Chain 'G':
    Compound: bacterioferritin
    Species: Escherichia coli K12 [TaxId:83333]
    Gene: bfr, b3336, JW3298
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e1jg_
  • Chain 'H':
    Compound: bacterioferritin
    Species: Escherichia coli K12 [TaxId:83333]
    Gene: bfr, b3336, JW3298
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e1jh_
  • Chain 'I':
    Compound: bacterioferritin
    Species: Escherichia coli K12 [TaxId:83333]
    Gene: bfr, b3336, JW3298
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e1ji_
  • Chain 'J':
    Compound: bacterioferritin
    Species: Escherichia coli K12 [TaxId:83333]
    Gene: bfr, b3336, JW3298
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e1jj_
  • Chain 'K':
    Compound: bacterioferritin
    Species: Escherichia coli K12 [TaxId:83333]
    Gene: bfr, b3336, JW3298
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e1jk_
  • Chain 'L':
    Compound: bacterioferritin
    Species: Escherichia coli K12 [TaxId:83333]
    Gene: bfr, b3336, JW3298
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3e1jl_
  • Heterogens: SO4, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e1jA (A:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e1jB (B:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e1jC (C:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e1jD (D:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e1jE (E:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e1jF (F:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e1jG (G:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e1jH (H:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e1jI (I:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e1jJ (J:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e1jK (K:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e1jL (L:)
    mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqireeg