PDB entry 3e11
View 3e11 on RCSB PDB site
Description: Crystal structure of a predicted zincin-like metalloprotease (acel_2062) from acidothermus cellulolyticus 11b at 1.80 A resolution
Class: unknown function
Keywords: Duf1025 family protein, zincin-like fold, conserved matrix metalloprotease motif, structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, unknown function
Deposited on
2008-08-01, released
2008-08-19
The last revision prior to the SCOPe 2.06 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.176
AEROSPACI score: 0.53
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: predicted zincin-like metalloprotease
Species: Acidothermus cellulolyticus 11B, synthetic [TaxId:351607]
Gene: YP_873820.1, Acel_2062
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d3e11a1, d3e11a2 - Chain 'B':
Compound: predicted zincin-like metalloprotease
Species: Acidothermus cellulolyticus 11B, synthetic [TaxId:351607]
Gene: YP_873820.1, Acel_2062
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d3e11b2, d3e11b3 - Heterogens: ACT, CA, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3e11A (A:)
gmvyvdpdrfdelvaealdgipeefaramrnvavfvedepddpellglyvgipltertta
yggvlpdriiiyrnticalcetesevidevrktvvheiahhfgidderlhelgy
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3e11B (B:)
gmvyvdpdrfdelvaealdgipeefaramrnvavfvedepddpellglyvgipltertta
yggvlpdriiiyrnticalcetesevidevrktvvheiahhfgidderlhelgy