PDB entry 3e0w

View 3e0w on RCSB PDB site
Description: Crystal structure of pyruvate kinase from Leishmania mexicana
Class: transferase
Keywords: PYRUVATE, KINASE, NAD+ NADH, ADP, PHOSPHOENOLPYRUVATE, PEP, GLYCOLYSIS, TRYPANOSOMATID, LEISHMANIA, MEXICANA, Allosteric enzyme, Magnesium, Metal-binding, Transferase
Deposited on 2008-08-01, released 2008-08-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.215
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyruvate kinase
    Species: Leishmania mexicana [TaxId:5665]
    Gene: PYK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q27686 (Start-538)
      • conflict (422)
      • conflict (429)
      • conflict (444-445)
      • engineered (491)
    Domains in SCOPe 2.06: d3e0wa1, d3e0wa2, d3e0wa3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3e0wA (A:)
    mgsshhhhhhssglvprgshmgsshhhhhhssglvprgshmsqlahnltlsifdpvanyr
    aariictigpstqsvealkgliqsgmsvarmnfshgsheyhqttinnvrqaaaelgvnia
    ialdtkgpeirtgqfvggdavmergatcyvttdpafadkgtkdkfyidyqnlskvvrpgn
    yiyiddgililqvqshedeqtlectvtnshtisdrrgvnlpgcdvdlpavsakdrvdlqf
    gveqgvdmifasfirsaeqvgdvrkalgpkgrdimiickienhqgvqnidsiieesdgim
    vargdlgveipaekvvvaqkiliskcnvagkpvicatqmlesmtynprptraevsdvana
    vfngadcvmlsgetakgkypnevvqymaricleaqsalneyvffnsikklqhipmsadea
    vcssavnsvyetkakamvvlsntgrsarlvakyrpncpivcvttrlqtcrqlnitqgves
    vffdadklghdwgkehrvaagvefakskgyvqtgdycvvihadhkvkgyanqtrillve
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e0wA (A:)
    ltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgsheyhqttinn
    vrqaaaelgvniaialdtkgpeirtgqfvggdavmergatcyvttdpafadkgtkdkfyi
    dyqnlskvvrpgnyiyiddgililqvqshedeqtlectvtnshtisdrrgvnlpgcdvdl
    pavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrkalgpkgrdimiickienhqgvq
    nidsiieesdgimvargdlgveipaekvvvaqkiliskcnvagkpvicatqmlesmtynp
    rptraevsdvanavfngadcvmlsgetakgkypnevvqymaricleaqsalneyvffnsi
    kklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncpivcvttrlq
    tcrqlnitqgvesvffdadklghdwgkehrvaagvefakskgyvqtgdycvvihadnqtr
    illve